Performance Audit of the Development Services Department’s Collection of Water and Sewer Fees

juggleroffbeatΚινητά – Ασύρματες Τεχνολογίες

19 Ιουλ 2012 (πριν από 5 χρόνια και 1 μήνα)

406 εμφανίσεις













  
 


  
 





   

 


 









2IILFHRIWKH&LW\$XGLWRU&LW\RI6DQ'LHJR
$XGLW5HSRUW
3HUIRUPDQFH$XGLWRI
WKH'HYHORSPHQW
6HUYLFHV'HSDUWPHQW
¶V
&ROOHFWLRQRI:DWHU
DQG6HZHU)HHV
-XQH

:HDN&RQWUROVDQG3RRU
,QWHUGHSDUWPHQWDO
&RRUGLQDWLRQDQG
&RPPXQLFDWLRQ5H
VXOWHG
LQ8QSDLG)HHV
2&$


















7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN





  

 

 

  

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB




 




 

































   

 
 
    



  


























'$7(
 -XQH
72
 +RQRUDEOH0HPEHUVRIWKH$XGLW&RPPLWWHH
)520
 (GXDUGR/XQD&LW\$XGLWRU
68%-(&7
 3HUIRUPDQFH$XGLWRIWKH'HYHORSPHQW6HUYLFHV'HSDUWPHQW¶V&ROOHFWLRQRI
:DWHUDQG6HZHU)HHV
(QFORVHGLVDSHUIRUPDQFHDXGLWUHSRUWRI
WKH
'HYHORSPHQW6HUYLFHV'HSDUWPHQW¶V
&ROOHFWLRQRI:DWHUDQG6HZHU)HHV7KLVUHSRUWZDVFRQGXFWHGLQDFFRUGDQFHZLWK
6HFWLRQRIWKH&LW\&KDUWHUDWWKHUHTXHVWRIWKH3XEOLF8WLOLWLHV'HSDUWPHQW
7KH
H[HFXWLYHVXPPDU\LVSUHVHQWHGRQSDJH

DQG
PDQDJ
HPHQW¶VUHVSRQVHWRRXUDXGLW
UHFRPPHQGDWLRQVFDQEHIRXQG
LQ
$WWDFKPHQW
³
$
´
DIWHUSDJH

RIWKLVUHSRUW
:HZRXOGOLNHWRWKDQNWKH'HYHORSPHQW6HUYLFH'HSDUWPHQWDQGWKH3XEOLF8WLOLWLHV
'HSDUWPHQWVWDII
ZKRSURYLGHGWKHLUWLPHDQGFRQWULEXWHGWKHLUH[
SHUWLVHWRWKLVUHSRUW

:HJUHDWO\DSSUHFLDWHWKHLUWLPHDQGHIIRUWV7KHDXGLWVWDIIUHVSRQVLEOHIRUWKLVDXGLW
UHSRUWLV6RQMD+RZH'HH'HH$ODULDQG.\OH(OVHU
5HVSHFWIXOO\VXEPLWWHG
(GXDUGR/XQD
&LW\$XGLWRU
FF
+RQRUDEOH0D\RU-HUU\6DQGHUV
+RQRUDEOH&LW\&RXQFLO0HPEHUV
-D\0*ROGVWRQH&KLHI2SHUDWLQJ2IILFHU
-DQ*ROGVPLWK&LW\$WWRUQH\
$QGUHD7HYOLQ,QGHSHQGHQW%XGJHW$QDO\VW
:DOO\+LOO$VVLVWDQW&KLHI2SHUDWLQJ2IILFHU
.HOO\%URXJKWRQ'HYHORSPHQW6HUYLFHV'HSDUWPHQW'LUHFWRU
$OH[
5XL]3XEOLF8WLOLWLHV'HSDUWPHQW'LUHFWRU
2)),&(2)7+(&,7<$8',725
6(&21'$9(18(
68,7(

Ɣ6$1',(*2&$
3+21(


)$;

















































7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN


  








   










































































7DEOHRI&RQWHQWV
([HFXWLYH6XPPDU\ 
,QWURGXFWLRQ 
2EMHFWLYHV6FRSHDQG0HWKRGRORJ\ 
$XGLW5HVXOWV 
&RQFOXVLRQ 
$WWDFKPHQW$±0DQDJHPHQW5HVSRQVH





 
  
 




 

 
  
 







 

   



















(;(&87,9(6800$5<
,QUHVSRQVHWRDUHTXHVWIURPWKH3XEOLF8WLOLWLHV'HSDUWPHQW 3XEOLF8WLOLWLHV ZHKDYH
FRQGXFWHGDQDXGLWRIWKH'HYHORSPHQW6HUYLFHV'HSDUWPHQW¶V '6' SURFHVVIRUWKHFROOHFWLRQ
RI:DWHUDQG6HZHUSHUPLWIHHV ,26IHHV 6SHFLILFDOO\ZHUHYLHZHGWKHLQWHUQDOSROLFLHVDQG
SURFHVVHVLQYROYHGLQWKHELOOLQJFROOHFWLRQDQGIROORZXSRI:DWHUDQG6HZHUSHUPLWIHHV:H
FRQGXFWHGWKLVDXGLWLQDFFRUGDQFHZLWK*HQHUDOO\$FFHSWHG*RYHUQPHQW$XGLWLQJ6WDQGDUGV
DQGOLPLWHGRXUZRUNWRWKRVHDUHDVVSHFLILHGLQWKH6FRSHDQG0HWKRGRORJ\VHFWLRQRIWKLV
UHSRUW
%DVHGRQRXUUHYLHZRIYDULRXVGLYLVLRQVZLWKLQ'6'DVZHOODVDXGLWWHVWLQJRIDQXPEHURI
UHSRUWVJHQHUDWHGE\WKH3XEOLF8WLOLWLHV'HSDUWPHQW¶V,QVWDOODWLRQ2UGHU6\VWHP ,26 WKDW
LGHQWLI\LQDSSURSULDWHO\LVVXHGSHUPLWVDQGLQDFFXUDWHO\HQWHUHGGDWDZHIRXQGWKDWGXULQJWKH
DXGLW\HDUVWHVWHG'6'GLGQRWPDLQWDLQDGHTXDWHFRQWUROVWRHQVXUHWKDWDOO,26IHHVZHUH
FRQVLVWHQWO\DQGDSSURSULDWHO\FKDUJHGDQGFROOHFWHG
:HIRXQGWKHIROORZLQJLVVXHVGXULQJRXUUHYLHZ
$VRI-XQHWKHUHZDVRYHULQXQFROOHFWHG,26IHHVIRUSURMHFWVZLWK
SHUPLWVLVVXHGDQGRUZLWKSURMHFWVWDWXVFRPSOHWH
'6'DQG3XEOLF8WLOLWLHVGRQRWPDLQWDLQD6HUYLFH/HYHO$JUHHPHQWRU0HPRUDQGXPRI
8QGHUVWDQGLQJGHWDLOLQJUHVSRQVLELOLWLHVDQGH[SHFWDWLRQVLQWKHDVVHVVPHQWFROOHFWLRQDQG
IROORZXSRI,26IHHV
:HPDGHVHYHQUHFRPPHQGDWLRQVIRUFRUUHFWLYHDFWLRQWKHGHWDLOVRIZKLFKFDQEHIRXQGLQWKH
$XGLW5HVXOWVVHFWLRQRIWKLVUHSRUW






   
 




 
 


   

  
 


 
 








 
 






            
      

,1752'8&7,21
,QDFFRUGDQFHZLWKRXUILVFDO\HDU$XGLW:RUN3ODQZHFRQGXFWHGDQDXGLWRIWKH
'HYHORSPHQW6HUYLFHV'HSDUWPHQW¶V '6' FROOHFWLRQRI:DWHUDQG6HZHUIHHVZKLFKDUH
DVVHVVHGDQGFROOHFWHGE\'6'RQEHKDOIRIWKH3XEOLF8WLOLWLHV'HSDUWPHQW 3XEOLF8WLOLWLHV 
%DFNJURXQG
'6'SURYLGHVUHYLHZSHUPLWLQVSHFWLRQDQGFRGHHQIRUFHPHQWVHUYLFHVIRUEXLOGLQJDQG
GHYHORSPHQWSURMHFWVWKURXJKRXWWKH&LW\RI6DQ'LHJR,WVPLVVLRQLVWRSURYLGHHIIHFWLYHVDIH
DQGTXDOLW\GHYHORSPHQWHQKDQFLQJ6DQ'LHJDQV¶TXDOLW\RIOLIHWKURXJKFRPPXQLW\FXVWRPHU
VHUYLFHDQGWLPHO\DQGHIIHFWLYHPDQDJHPHQWRIGHYHORSPHQWDQGFRPSOLDQFHSURFHVVHV'6'
LVVXHGDWRWDORIDSSUR[LPDWHO\EXLOGLQJSHUPLWVRYHUILVFDO\HDUVDQG
'6'FROOHFWVYDULRXVIHHVIRUVHYHUDO&LW\HQWLWLHVLQFOXGLQJ3XEOLF8WLOLWLHV$PRQJWKH
QXPHURXVIHHVFROOHFWHG'6'PD\FROOHFWDYDULHW\RI3XEOLF8WLOLWLHVIHHVIRUZDWHUDQGVHZHU
DFFHVVDQGUHODWHGVHUYLFHVDVZHOODVFDSDFLW\UHODWHGIHHV SURMHFWVSURSRVLQJWRDGGRUUHPRYH
ZDWHUDQGVHZHUIL[WXUHV DVZHOODVIRUZRUNWREHGRQHRQWKHSURSHUW\ $OOIHHW\SHVDUHQRW
QHFHVVDULO\DVVHVVHGIRUHDFKSURSHUW\UHYLHZHG)HHVLQFOXGH
 6WDQGDUG:DWHUDQG6HZHU,QVWDOODWLRQ
 &DSDFLW\&KDUJHVDQG'HIHUUHG&DSDFLW\&KDUJHV
 &RXQW\:DWHU$XWKRULW\ &:$ &DSDFLW\&KDUJHV


 5HLPEXUVHPHQW$JUHHPHQWVDQG
 2WKHU&RQQHFWLRQV:DWHU0DLQ&RQQHFWLRQIHHV
'HYHORSPHQW6HUYLFHV'HSDUWPHQW¶V3HUPLW3URFHVV
7KHSHUPLWSURFHVVDW'6'LVFRPSOH[DQGYDULHVE\WKHW\SHVL]HDQGHYHQORFDWLRQRIDSURMHFW
ZLWKLQWKH&LW\RI6DQ'LHJR3URMHFWVUHYLHZHGIRUFRQVWUXFWLRQEXLOGLQJSHUPLWVZLWKLQWKH
&LW\RI6DQ'LHJRDUHSURFHVVHGE\'6'ZKLFKRSHUDWHVDQXPEHURIVHFWLRQVWRH[SHGLWH
SURMHFWVRIYDULRXVW\SHVDQGVL]HV)RUH[DPSOHVPDOOHUSURMHFWVVXFKDVDWHQDQWLPSURYHPHQW
DFRPPHUFLDOUHPRGHO ZRXOGPRVWOLNHO\EHVXEPLWWHGWR2YHUWKH&RXQWHU5HYLHZ 27& DQG
WKHUHYLHZFRXOGOLNHO\EHFRPSOHWHGE\FORVHRIEXVLQHVVWKHVDPHGD\7KHSHUPLWSURFHVVIRU
WHQDQWLPSURYHPHQWZKLOHIXQGDPHQWDOO\LGHQWLFDOLVGLIIHUHQWWKDQWKDWRIDGHYHORSHUVHHNLQJ
WRFRQVWUXFWDFRQGRPLQLXPFRPSOH[GXHWRWKHFRPSOH[LW\RIODUJHUFRQVWUXFWLRQDQGWKHQHHG
IRULQGHSWKUHYLHZDFURVVDQXPEHURIGLVFLSOLQHV

&RXQW\:DWHU$XWKRULW\)HHVDUHFROOHFWHGE\'6'IRU3XEOLF8WLOLWLHVRQEHKDOIRIWKH&RXQW\:DWHU$XWKRULW\
7KH\UDQJHIURPWRSHUPHWHU







 

 



 
 
 

 




  

 

 
 

  


 







      
              

           
    































'6'¶V3HUPLW3URFHVVIRU&RPELQHG5HYLHZIRU6XEPLWWHG3URMHFWV
)RXURI'6'¶V3ODQ5HYLHZ6SHFLDOLVWVZKRFRQGXFWUHYLHZVUHVXOWLQJLQWKHDVVHVVPHQWRI
,26IHHVIDOOZLWKLQWKHGHSDUWPHQW¶V&RPELQHG5HYLHZIRU6XEPLWWHG3URMHFWVGLYLVLRQ
,QIRUPDWLRQDQG$SSOLFDWLRQ6HUYLFHVVHFWLRQ $VWKHVH3ODQ5HYLHZ6SHFLDOLVWVUHYLHZQHZ
FRQVWUXFWLRQSURMHFWVWKH\JHQHUDWHWKHPDMRULW\RI,26IHHV
$ORQJZLWKWKHEXLOGLQJSODQVFXVWRPHUVZKRDQWLFLSDWHZDWHUDQGVHZHUQHHGVZLOODOVRVXEPLW
D:DWHU0HWHU'DWD&DUGZKLFKLVXVHGWRGHWHUPLQHWKHFRUUHFWVL]HUHTXLUHGIRUWKHZDWHU
PHWHUZDWHUVHUYLFHDQGVHZHUODWHUDO7KH:DWHU0HWHU'DWD&DUGLQFOXGHVGHWDLOVDERXWWKH
QXPEHUDQGVL]HVRIDSSOLDQFHVRUIL[WXUHVVXFKDVVLQNVEDWKWXEVVKRZHUKHDGVXULQDOVDQG
ODZQVSULQNOHUKHDGV7KH,QIRUPDWLRQDQG$SSOLFDWLRQ6HUYLFHVVHFWLRQFRQGXFWVLQGHSWK
UHYLHZVIRU]RQLQJFRPSOLDQFHZLWKWKH/DQG'HYHORSPHQW&RGHDQG7LWOH

 3ODQ5HYLHZ
6SHFLDOLVWVDOVRFRQGXFWDZDWHUDQGVHZHUUHYLHZZKLFKLQFOXGHVIDPLOLDUL]LQJWKHPVHOYHVZLWK
WKHKLVWRU\RIWKHSURMHFWE\UHVHDUFKLQJYDULRXVPDSVGRFXPHQWDWLRQDERXWWKHSURSHUW\LQ
'6'¶V3URMHFW7UDFNLQJ6\VWHP 376 DQGRWKHUSHUWLQHQWLQIRUPDWLRQWRGHWHUPLQHZKHWKHUWKH
SURSRVHGFRQVWUXFWLRQFRPSOLHVZLWK:DWHUDQG6HZHUUHJXODWLRQVDQGWRHQVXUHWKDWWKH:DWHU
0HWHU'DWD&DUGLVDFFXUDWH

3ODQ5HYLHZ6SHFLDOLVWVNHHSFXVWRPHUVDSSULVHGRIWKHLUSURMHFWV¶SURJUHVVDQGLIQHFHVVDU\
UHTXHVWDGGLWLRQDOLQIRUPDWLRQRUFKDQJHVWRWKHSODQV2QFHWKHEXLOGLQJSODQVDUHDSSURYHGWKH
IL[WXUHQXPEHUVDQGVL]HVDUHHQWHUHGLQWR3XEOLF8WLOLWLHV¶,QVWDOODWLRQ2UGHU6\VWHP ,26 IRU
ILQDOIHHDVVHVVPHQW
2QFHWKHEXLOGLQJSODQVKDYHEHHQDSSURYHGDFURVVDOOGLVFLSOLQHVFXVWRPHUVDUHLVVXHGD376
LQYRLFHDQGDVHSDUDWH,26LQYRLFHIRUZDWHUDQGVHZHUIHHV

7KH,26LQYRLFHLVYDOLGRQO\WKH
GD\LWLVLVVXHG$OWKRXJKFXVWRPHUVDUHLVVXHGLQYRLFHVIRUERWK,26DQG376SD\PHQWVIRU
ERWKLQYRLFHVDUHWUDFNHGLQ376'6'FDVKLHUVPXVWPDQXDOO\HQWHUSD\PHQWLQIRUPDWLRQLQWR
,26IRU376DFFRXQWVZLWKDFRUUHVSRQGLQJ,26DFFRXQWLQYRLFH3HUPLWVVKRXOGRQO\EHLVVXHG
RQFHDOOIHHVDUHSDLG
)LJXUHLOOXVWUDWHVDVLPSOLILHGYHUVLRQRIWKHSHUPLWSURFHVVIRU&RPELQHG5HYLHZIRU
6XEPLWWHG3URMHFWVWKHGLYLVLRQDW'6'WKDWKDQGOHVWKHPDMRULW\RI,26IHHV

7LWOHGHDOVZLWK5HVLGHQWLDO(QHUJ\&RQVHUYDWLRQFRPSOLDQFH

7KH:DWHU 0HWHU'DWD &DUG LV UHTXLUHG IRU DOO ZDWHU DQG VHZHU SHUPLWV DGGLQJ RU UHPRYLQJ HTXLYDOHQW IL[WXUH
XQLWV

,WVKRXOGEHQRWHGWKDWQRWDOODFFRXQWVKDYHDSSOLFDEOH,26IHHV,QWKLVFDVHFXVWRPHUVZRXOGQRWEHLVVXHGDQ
,26LQYRLFH 6LPLODUO\QRWDOO,26DFFRXQWVKDYHDFRUUHVSRQGLQJ376DFFRXQW














  
  

    

















)LJXUH
3XEOLF8WLOLWLHV'HSDUWPHQW
3XEOLF8WLOLWLHVLVFRPSULVHGRIWKH&LW\RI6DQ'LHJR¶V:DWHUDQG0HWURSROLWDQ:DVWHZDWHU
'HSDUWPHQWVZKLFKPHUJHGLQLQRUGHUWRSURYLGHDPRUHHIILFLHQWRUJDQL]DWLRQ,WVPLVVLRQ
LVWRSURYLGHDVDIHHIILFLHQWDQGFRVWHIIHFWLYHZDWHUDQGUHJLRQDOVHZHUDJHV\VWHPWKDW
VXSSOHPHQWVWKHUHJLRQ¶VOLPLWHGZDWHUVXSSO\DQGPHHWVUHJXODWRU\VWDQGDUGVLQDQ
HQYLURQPHQWDOO\VHQVLWLYHPDQQHU
:LWKLQ3XEOLF8WLOLWLHVWKH,266HFWLRQLVUHVSRQVLEOHIRUPDQDJLQJDQGUHYLHZLQJWKHFROOHFWLRQ
RI&LW\ZDWHUDQGVHZHUIHHV7KLVVHFWLRQLVFRPSULVHGRIRQH,26&RRUGLQDWRUZKRRYHUVHHV
GDWDHQWULHVLQWR,26 DPDLQIUDPHV\VWHP ZKLFKLQFOXGHVWKHFROOHFWLRQRI&LW\:DWHUDQG
6HZHUIHHV&RXQW\:DWHU$XWKRULW\FDSDFLW\IHHVDVZHOODVWKHVFKHGXOLQJRIZDWHUDQGVHZHU
UHODWHGZRUNRUGHUVIRUVHUYLFHVWRFXVWRPHUVWKURXJKRXWWKH&LW\7KH,26&RRUGLQDWRULVDOVR
UHVSRQVLEOHIRUQRWLI\LQJ'6'RIDQ\HUURUVFRQFHUQLQJ,26$6HUYLFH/HYHO$JUHHPHQW 6/$ 
GRHVQRWFXUUHQWO\H[LVWEHWZHHQ3XEOLF8WLOLWLHVDQG'6'UHJDUGLQJWKHDVVHVVPHQWDQG
FROOHFWLRQRIZDWHUDQGVHZHUSHUPLWIHHV









 


 

 











  

 










            
         

$XGLW2EMHFWLYH6FRSHDQG0HWKRGRORJ\
7KHREMHFWLYHRIWKLVDXGLWZDVWRGHWHUPLQHZKHWKHU'6'KDVHIIHFWLYHDQGHIILFLHQWSROLFLHV
SURFHGXUHVDQGLQWHUQDOFRQWUROVWRHQVXUHWKHSURSHUFROOHFWLRQRI:DWHUDQG6HZHUSHUPLWIHHV
,26IHHV 7RWKLVHQGZHFRQGXFWHGDUHYLHZRI'6'¶VSROLFLHVSURFHGXUHVDQGLQWHUQDO
FRQWUROVDVWKH\SHUWDLQHGWRWKHDVVHVVPHQWDQGFROOHFWLRQRI,26IHHVGXULQJILVFDO\HDUV
WKURXJKDVZHOODVWKHSURFHGXUHVLQSODFHIRUWKHUHFRYHU\RIXQFROOHFWHG:DWHUDQG6HZHU
SHUPLWIHHVGXULQJWKDWVDPHSHULRG
7KHIROORZLQJDXGLWPHWKRGRORJ\ZDVXVHGWRDFKLHYHRXUDXGLWREMHFWLYH
2EWDLQHGDQGUHYLHZHGUHOHYDQWZULWWHQSROLFLHVSURFHGXUHVDQGPDQXDOVDQG
GHSDUWPHQWDOGRFXPHQWVUHODWHGWRWKHDVVHVVPHQWDQGFROOHFWLRQRI,26SHUPLWIHHV
,QWHUYLHZHG3XEOLF8WLOLWLHVDQG'6'VWDIIWKDWDUHLQYROYHGLQWKHDVVHVVPHQWRI,26
IHHVWKHFROOHFWLRQRI,26IHHVDQGWKHIROORZXSRIXQSDLG,26IHHV
,QWHUYLHZHG3XEOLF8WLOLWLHVDQG'6'VWDIIUHJDUGLQJ'6'¶V3URMHFW7UDFNLQJ6\VWHP
376 DQG3XEOLF8WLOLWLHV¶,QVWDOODWLRQ2UGHU6\VWHP ,26 
2EWDLQHGDQGUHYLHZHG,26UHSRUWVIRUILVFDO\HDUVDQG
$QDO\]HGDQGWHVWHGGDWDRQILVFDO\HDU,26UHSRUWV

:HHYDOXDWHGLQWHUQDOFRQWUROVUHODWHGWRWKHDXGLWREMHFWLYHV2XUUHYLHZIRFXVHGRQFRQWUROV
UHODWHGWRWKHGHSDUWPHQW¶VDVVHVVPHQWDQGFROOHFWLRQRI,26IHHVDVZHOODVWKHIROORZXSRI
XQSDLG,26IHHV2XUFRQFOXVLRQVRQWKHHIIHFWLYHQHVVRIWKHFRQWUROVZHUHYLHZHGDUHGHWDLOHG
LQWKHIROORZLQJDXGLWUHVXOWV7KLVDXGLWGLGQRWUHYLHZWKHFRVWDSSURSULDWHQHVVRI:DWHUDQG
6HZHUIHHV
:HFRQGXFWHGWKLVSHUIRUPDQFHDXGLWLQDFFRUGDQFHZLWKJHQHUDOO\DFFHSWHGJRYHUQPHQW
DXGLWLQJVWDQGDUGV7KRVHVWDQGDUGVUHTXLUHWKDWZHSODQDQGSHUIRUPWKHDXGLWWRREWDLQ
VXIILFLHQWDSSURSULDWHHYLGHQFHWRSURYLGHDUHDVRQDEOHEDVLVIRURXUILQGLQJVDQGFRQFOXVLRQV
EDVHGRQRXUDXGLWREMHFWLYHV:HEHOLHYHWKDWWKHHYLGHQFHREWDLQHGSURYLGHVDUHDVRQDEOHEDVLV
IRURXUILQGLQJVDQGFRQFOXVLRQVEDVHGRQRXUDXGLWREMHFWLYHV

-XVW SULRU WR WKH LVVXDQFH RI WKLV UHSRUW 3XEOLF 8WLOLWLHV SURYLGHG D ODUJH GDWD VHW WKDW UHTXLUHV DGGLWLRQDO WHVWLQJ
$Q\ILQGLQJVUHYHDOHGDVDUHVXOWRIWKLVWHVWLQJZLOOEHUHSRUWHGLQDVHSDUDWHPHPR







 

 

 
 

 





 

  




  

 
 

 


 
 





$8',75(68/76
:($.,17(51$/&21752/6$1'3225,17(5'(3$570(17 $/
&225',1$7,21$1'&20081,&$7,21'85,1*7+($8',73(5,2'
5(68/7(',129(52)81&2//(&7(',26)((6$62)
'6'DVVHVVHVEXLOGLQJSODQVDQGFROOHFWVSHUPLWIHHVIRUDOOVWUXFWXUHVEXLOWZLWKLQWKH&LW\RI
6DQ'LHJR7RWKLVHQG'6'SURYLGHVZDWHUDQGVHZHUUHYLHZIRUFXVWRPHUVDQGSHUPLWIHH
FROOHFWLRQRQEHKDOIRI3XEOLF8WLOLWLHVIRUEXLOGLQJSODQVUHTXLULQJDFFHVVWRZDWHUPDLQVDQG
VHZHUODWHUDOV,QFRQGXFWLQJRXUDXGLWZHORRNHGDWDQXPEHURI'6'¶VSURFHVVHVLQYROYHGLQ
WKHELOOLQJDQGFROOHFWLRQRI,26IHHVGXULQJILVFDO\HDUV±'6'DGYLVHGWKDWLWKDV
PDGHDQXPEHURIFKDQJHVVLQFHWKHHQGRIILVFDO\HDULQFOXGLQJWKHLQFOXVLRQRI,26IHHV
RQ'6'¶VSULPDU\LQYRLFHLPSOHPHQWDWLRQRIQHZSURFHGXUHVLQSD\PHQWFROOHFWLRQRI,26IHHV
E\FDVKLHUVDQGHVWDEOLVKPHQWRIDQHZSROLF\IRUWKHUHFRYHU\RIXQSDLGIHHVWKDWPD\OHVVHQ
HUURUVIRUWKHSHULRGXQGHUUHYLHZKRZHYHUGXULQJWKHSHULRGWHVWHGZHIRXQGZHDNFRQWUROV
DQGSRRULQWHUGHSDUWPHQWDOFRRUGLQDWLRQDQGFRPPXQLFDWLRQUHJDUGLQJWKHFROOHFWLRQRI:DWHU
DQG6HZHUSHUPLWIHHV ,26IHHV LQFOXGLQJ
'6'ODFNVDSROLF\RUSURFHGXUHWRUHFRYHUXQSDLG,26IHHVUHVXOWLQJLQRYHULQ
XQFROOHFWHGIHHVDVRI
'6'DQG3XEOLF8WLOLWLHVGRQRWPDLQWDLQD6HUYLFH/HYHO$JUHHPHQWRU0HPRUDQGXPRI
8QGHUVWDQGLQJGHWDLOLQJUHVSRQVLELOLWLHVDQGH[SHFWDWLRQVLQWKHDVVHVVPHQWFROOHFWLRQDQG
IROORZXSRI,26SHUPLWIHHV
,QDGGLWLRQZHLGHQWLILHGZHDNFRQWUROVUHJDUGLQJWKHDVVHVVPHQWRI,26IHHV7KHVHLQFOXGH
'6'DQG3XEOLF8WLOLWLHVGRQRWDGHTXDWHO\XSGDWHSURFHGXUHVIRUWKHDVVHVVPHQWRI,26
IHHV
'6'3ODQ5HYLHZ6SHFLDOLVWVGRQRWUHFHLYHDGHTXDWHWUDLQLQJRQWKHDVVHVVPHQWRI,26
SHUPLWIHHVQRUDUHDVVHVVPHQWVSHULRGLFDOO\UHYLHZHG
$FFRUGLQJWR'6'QRQSD\PHQWRIIHHV LQFOXGLQJ,26IHHV VKRXOGUHVXOWLQDKROGEHLQJ
SODFHGRQDQDFFRXQW:KLOHRQKROG&LW\VWDIIVKRXOGQRWSHUIRUPVHUYLFHVRQEHKDOIRID
SURMHFWWKHILQDOLQVSHFWLRQVKRXOGQRWRFFXUDQG'6'EXLOGLQJLQVSHFWRUVVKRXOGQRWLVVXH
FHUWLILFDWHVRIFRPSOHWLRQRFFXSDQF\IRUWKHSURSHUW\
$FFRUGLQJWR'6'WKHUHDUHUDUHH[FHSWLRQVWRWKHUXOHWKDWSHUPLWVVKRXOGQRWEHLVVXHGZLWKRXW
IHHVEHLQJSDLG)RUH[DPSOHWKHGHSDUWPHQWPD\LVVXHDSHUPLWZLWKRXWIHHSD\PHQWIRU
FRQWUDFWRUVVHHNLQJWRPHHWDGHDGOLQHIRU6HFWLRQKRXVLQJ6HFWLRQSURMHFWVDUHWLHGWR
IHGHUDOIXQGVWKDWQHHGWRKDYHDSHUPLWLQKDQGSULRUWRDFHUWDLQGDWH7KHVHGHDGOLQHVGRQRW



  



 

  
 








 







 




 




           
         
          
         
    
             
     











































DOZD\VFRLQFLGHZLWKWKHZDWHUVHZHUUHYLHZ,QWKHVHLQVWDQFHVFRQWUDFWRUVZRXOGORVHWKHLU
IXQGLQJXQOHVVWKH\FDQGLVSOD\DEXLOGLQJSHUPLWWRWKHIHGHUDOJRYHUQPHQW'6'ZLOODOORZ
WKHPWRREWDLQWKHLUSHUPLWLQRUGHUWRVDWLVI\WKHLUIXQGLQJUHTXLUHPHQWVDWWKHIHGHUDOOHYHO
7KHVHFXVWRPHUVFDQQRWREWDLQDQ\LQVSHFWLRQVIRUWKHLUSURMHFWVXQWLODOOIHHVDUHSDLG
$FFRUGLQJWR'6'PDQDJHPHQW6HFWLRQSURMHFWVUHFHLYLQJSHUPLWVSULRUWRSD\PHQWLVUDUH
KDSSHQLQJPD\EHWZLFHD\HDU'6'GRHVQRWNHHSUHFRUGVRIWKHVHH[FHSWLRQVEXWQRWHVWKDW
KROGVDUHSODFHGRQDFFRXQWVVRWKDWQRZRUNLVSURYLGHGXQWLODOOSD\PHQWVKDYHEHHQPDGH
7KHVDPHLVWUXHRIFXVWRPHUVZKRWDNHDGYDQWDJHRIFDSDFLW\FKDUJHGHIHUUDOVRIIHUHGE\3XEOLF
8WLOLWLHV&XVWRPHUVFDQGHOD\SD\PHQWRIFDSDFLW\IHHVIRUPRQWKVRUXQWLOSURMHFW
FRPSOHWLRQEXWIXOOSD\PHQWSOXVDQDGGLWLRQDOVL[SHUFHQWLQWHUHVWLVGXHSULRUWRFXVWRPHUV
REWDLQLQJDILQDO'6'LQVSHFWLRQ'HIHUUDOVDUHPRQLWRUHGE\3XEOLF8WLOLWLHVZKLFKHVWLPDWHV
EHWZHHQRQHDQGWZRGHIHUUDOVD\HDU
$VRI-XQHWKHUHZDVLQXQFROOHFWHG:DWHUDQG6HZHUIHHV
3XEOLF8WLOLWLHVVWDIIXVHVL[,26V\VWHPUHSRUWVWRPRQLWRU'6'¶VSHUIRUPDQFHLQWKHDVVHVVPHQW
DQGFROOHFWLRQRI,26SHUPLWIHHV7KHVL[UHSRUWVFDQEHGLYLGHGLQWRWZRFDWHJRULHVQRQ
PRQHWDU\EDVHGDQGPRQHWDU\EDVHG

$VWKH,26&RRUGLQDWRULGHQWLILHV,26DFFRXQWVZLWK
LVVXHVRIFRQFHUQ

'6'VXSHUYLVRU\VWDIILVQRWLILHGLQRUGHUIRUFRUUHFWLRQVWREHPDGH'6'
6XSHUYLVRU\VWDIIUHOD\VLWHPVWRVWDIIZKRZRUNHGRQHDFKSDUWLFXODUSURMHFW&RUUHFWLRQVDUH
PDGHDV'6'VWDIIKDVDYDLODEOHWLPHWRUHYLHZLWHPVRIFRQFHUQ6XSHUYLVRUVGRQRWDFWLYHO\
PRQLWRUVWDII¶VFRUUHFWLRQVWRHQVXUHWKH\DUHKDQGOHGLQDWLPHO\PDQQHU
2QWKH,26UHSRUWHQWLWOHG³8QSDLG,262UGHUVZLWK3763HUPLWV,VVXHG´GDWHG-XQH
ZHLGHQWLILHGDFFRXQWVLQZKLFKSHUPLWVZHUHLVVXHGZLWKRXW,26IHHVEHLQJSDLGIRUDWRWDO
RI2IWKRVHDFFRXQWVZHIRXQGWKDW'6'LQVSHFWRUVKDGLVVXHGFHUWLILFDWHVRI
RFFXSDQF\IRUSHUFHQWRIWKRVHDFFRXQWV2QFHFHUWLILFDWHVRIRFFXSDQF\DUHLVVXHGLW
EHFRPHVLQFUHDVLQJO\GLIILFXOWIRUWKH&LW\WRFROOHFWXQSDLGIHHVVLQFHDOOZRUNKDVDOUHDG\EHHQ
SURYLGHG
5HFRPPHQGDWLRQ
'6'VKRXOGUHYLVHLWVFROOHFWLRQSURFHVVHVWRHQVXUHWKDWEXLOGLQJSHUPLWVDQGFHUWLILFDWHVRI
RFFXSDQF\DUHQRWEHLQJLVVXHGWRFXVWRPHUVSULRUWRIXOOSD\PHQWRIDOOGHYHORSPHQWIHHV
LQFOXGLQJZDWHUIHHV

7KUHHRIWKHUHSRUWVGHDOZLWKHUURUVRURPLVVLRQVGXHWRLQDFFXUDWHGDWDHQWU\E\'6'VWDII$GPLQLVWUDWLYH+ROGV
,QYDOLG3761XPEHURU$SSURYDO1XPEHUDQG,QFRPSOHWH7UDQVDFWLRQV 7KHUHPDLQLQJWKUHHUHSRUWVGHDOZLWK,26
DFFRXQWVWKDWKDYHEHHQSDLGZLWKEDGFKHFNVDQGRUDFFRXQWVZKHUHSHUPLWVKDYHEHHQLVVXHGEXWZKHUHWKH,26
LQYRLFHKDVQRWEHHQSDLGWKH3763HUPLWV,VVXHGZLWK,26)HHV1RW3DLG5HSRUWWKH%3,63HUPLWV,VVXHGZLWK
,26)HHV1RW3DLG5HSRUWDQGWKH16)&KHFNV5HSRUW

,VVXHV RI FRQFHUQ LQFOXGH LWHPV VXFK DV FXVWRPHU ZDWHU ELOOLQJ HUURUV FRQIOLFWLQJ LQIRUPDWLRQ,26 VHWXS HUURUV
DGGLWLRQDOIHHVGXHDQGRUIHHVFKDUJHGLQHUURU











  
 
 




  


 
 


  
  

 

 
  


 





             
       


6HH5HFRPPHQGDWLRQIRUFROOHFWLRQRIXQSDLGIHHV
'6'DQG3XEOLF8WLOLWLHVGRQRWPDLQWDLQD6HUYLFH/HYHO$JUHHPHQWRU0HPRUDQGXPRI
8QGHUVWDQGLQJGHWDLOLQJUHVSRQVLELOLWLHVDQGH[SHFWDWLRQVLQWKHDVVHVVPHQWFROOHFWLRQDQG
IROORZXSRI,26IHHV
6HUYLFHVSURYLGHGLQWHUQDOO\EHWZHHQWZRRUPRUH&LW\GHSDUWPHQWVVHUYHVDVDYLWDOVXSSRUW
IXQFWLRQLQPHHWLQJWKHRYHUDOOREMHFWLYHVRIWKH&LW\RI6DQ'LHJRLQSURYLGLQJVHUYLFHVDQG
PDQDJLQJUHVRXUFHVLQDPDQQHUWKDWKRQRUVWKHWUXVWSODFHGLQWKH&LW\E\LWVVWDNHKROGHUV7KH
&LW\RI6DQ'LHJR¶V6HUYLFH/HYHO$JUHHPHQW 6/$ *XLGHVXJJHVWVWKDW6HUYLFH/HYHO
$JUHHPHQWV 6/$V DUHQRH[FHSWLRQDV6/$VGRFXPHQWFRPPLWPHQWQRWRQO\WRSURYLGLQJ
LQWHUQDOVHUYLFHVXSSRUWEXWDOVRWRSURWHFWLQJWKHLQWHJULW\RIVXFKWUDQVDFWLRQVWKURXJKFOHDUO\
GHILQHGSHUIRUPDQFHPHDVXUHVDVZHOODVUHSRUWLQJDQGPRQLWRULQJSURWRFROV$Q6/$LVD
GRFXPHQWGHYHORSHGE\HQWLWLHVWKDWFOHDUO\GHILQHVWKHQDWXUHRIVHUYLFHV VFRSH WLPLQJDQG
GHOLYHUDEOHVRIWKHVHUYLFHVSURYLGHGDQGWKHUROHVDQGUHVSRQVLELOLWLHVRISURYLGHUDQGFOLHQWDV
ZHOODVFHUWDLQSURFHGXUDOUHTXLUHPHQWV
7KHODVWVLJQHG6/$EHWZHHQ3XEOLF8WLOLWLHVDQG'6'IRU3RWDEOH:DWHUDQG6HZHU3HUPLW 
3ODQ5HYLHZZKLFKGHWDLOHGH[SHFWDWLRQVUHJDUGLQJGHVLJQUHYLHZWXUQDURXQGWLPHWKHVHSDUDWH
UHVSRQVLELOLWLHVRIWKHWZRGHSDUWPHQWVDQGGHSDUWPHQWFRPPXQLFDWLRQVH[SLUHGLQ:KLOH
D0HPRUDQGXPRI8QGHUVWDQGLQJ 028

ZDVGUDIWHGEHWZHHQWKHWZR'HSDUWPHQWVIRU)LVFDO
<HDUWKHWHUPVZHUHQRWPXWXDOO\DFFHSWDEOHDQGWKH028ZDVQHYHUVLJQHG1R6/$RU
028H[LVWVDWWKLVWLPH
$FFRUGLQJWRWKH&LW\¶V6HUYLFH/HYHO$JUHHPHQW*XLGH³D6HUYLFH/HYHO$JUHHPHQW 6/$ LV
DQLQWHUQDOFRQWUDFWQHFHVVLWDWHGZKHQPRQLHVDUHWUDQVIHUUHGIURPRQH&LW\IXQGWRDQRWKHUFLW\
IXQGDVSD\PHQWIRUHVVHQWLDOVHUYLFHVUHQGHUHGE\WKHSURYLGHGWRWKHFOLHQW´DQGWKDW³WKH6/$
GHILQHVWKHUHODWLRQVKLSEHWZHHQWKHWZRSDUWLHVWKHVHUYLFHSURYLGHUDQGFOLHQWGHSDUWPHQWDQG
PXVWEHSUHSDUHGDQGVLJQHGE\ERWKSDUWLHV´+RZHYHU'6'LVQRWFRPSHQVDWHGE\3XEOLF
8WLOLWLHV,QVWHDGLWREWDLQVFRPSHQVDWLRQE\FKDUJLQJFXVWRPHUVSODQUHYLHZIHHV7KH
GHYHORSPHQWDQGPDLQWHQDQFHRIDQ6/$028RUDQ\RWKHUFRPSDUDEOHRIILFLDOGRFXPHQWLVD
EHVWSUDFWLFHWKDWZRXOGSURYLGHJXLGDQFHWRERWKGHSDUWPHQWV
$FFRUGLQJWRWKHODVWDFWLYH6/$'6'LVUHVSRQVLEOHIRUWKHDVVHVVPHQWDQGFROOHFWLRQRIDOO
&LW\:DWHUDQG6HZHUSHUPLWIHHVLQFOXGLQJWKRVHGXHE\WKH&LW\WRWKH0HWURSROLWDQ&RXQW\
:DWHU$XWKRULW\ &:$ IRUDQWLFLSDWHGLQFUHDVHLQXVDJH7KH6/$VSHFLILFDOO\VWDWHVWKDW'6'
ZLOODPRQJRWKHUWDVNV

$0HPRUDQGXPRI 8QGHUVWDQGLQJ 028 LVDGRFXPHQWWKDWH[SUHVVHVPXWXDODFFRUGRQDQLVVXHEHWZHHQWZRRU
PRUH SDUWLHV ZKLOH D 6HUYLFH/HYHO $JUHHPHQW LV JHQHUDOO\ DQ DJUHHPHQW EHWZHHQ D VHUYLFH SURYLGHU DQG D
FXVWRPHU



   
 


  
  






 


   

   

 

 
















               
























































'HWHUPLQHSRWDEOHZDWHU

VHUYLFHDQGVHZHUODWHUDOLQVWDOODWLRQVL]HVDQGDSSURSULDWHIHHV
$FFXUDWHO\LGHQWLI\H[LVWLQJSRWDEOHZDWHUVHUYLFHVDQGVHZHUODWHUDOVWREHGLVFRQQHFWHG
DQGFROOHFWWKHDVVRFLDWHGIHHVIRUVXFKZRUN
$FFXUDWHO\VHWXS1HZ6HUYLFH5HTXHVWV 1664 LQ,26WRHVWDEOLVKQHZDQGRUDGGWRRU
UHGXFHH[LVWLQJSRWDEOHZDWHUELOOLQJDFFRXQWV
$FFXUDWHO\FRPSXWHSRWDEOHZDWHUDQGVHZHUFDSDFLW\IHHVDQGFDSDFLW\FUHGLWV
$FFXUDWHO\DVVHVV&:$IHHVZKHQDSRWDEOHZDWHUPHWHULVVROG
$FFXUDWHO\GHWHUPLQHSRWDEOHZDWHUDQGVHZHUODWHUDOFRQQHFWLRQVDQGIHHVDQG
5HVSRQGWRDQGFRUUHFWHUURUVDVVRRQDVSRVVLEOH
7RWKLVHQG'6'¶V3ODQ5HYLHZ6SHFLDOLVWVXWLOL]H3XEOLF8WLOLWLHV¶,QVWDOODWLRQ2UGHU6\VWHP
,26 WRVHWXSQHZ,26DFFRXQWVIRUHDFKFXVWRPHUVXEPLWWLQJSODQVWKDWUHTXLUHZDWHUDQG
VHZHUDFFHVV,26LVSURJUDPPHGZLWKDVFKHGXOHRIIHHVWRJHQHUDWHWRWDOIHHDPRXQWVIRUZDWHU
DQGVHZHUQHHGVIRUWKHSURSHUW\XQGHUUHYLHZ$IWHUSODQVDUHDSSURYHGFXVWRPHUVDUHLVVXHG
DQ,26LQYRLFHDQGSD\PHQWVDUHFROOHFWHGE\'6'¶V&DVKLHUVGLYLVLRQ
:KLOHWKHODVW6/$GLGQRWVSHFLILFDOO\DGGUHVVWKHH[SHFWDWLRQRUDJUHHPHQWRI'6'WR
DSSURSULDWHO\FROOHFWWKHIHHVZKLFKLWKDVDFFXUDWHO\DVVHVVHGZHEHOLHYHLWWREHDQLPSOLHG
DJUHHPHQWDQGH[SHFWDWLRQ:KLOHWKHQXPEHURIDFFRXQWVZLWKSHUPLWVLVVXHGZLWKRXWIXOO
SD\PHQWPD\EHGXHLQSDUWWRH[FHSWLRQVSHUPLWWHGE\RQHRUERWKRIWKHGHSDUWPHQWVWKH
QXPEHURIDFFRXQWVZLWKFHUWLILFDWHVRIRFFXSDQF\LVVXHGE\'6'LQVSHFWRUVGHVSLWHWKH
H[LVWHQFHRIXQSDLGIHHVVXJJHVWVFRQWUROZHDNQHVVHVH[LVWLQ'6'¶VSHUPLWSURFHVV 7KHVH
ZHDNQHVVHVFUHDWHDQDWPRVSKHUHLQZKLFKFROOHFWLRQRIIHHVEHFRPHVGLIILFXOWDVFXVWRPHUVDUH
QRWLILHGRIXQSDLGIHHVDIWHUWKH\KDYHFRPSOHWHGWKH'6'SURFHVVDQGLQVRPHFDVHVDIWHUWKH\
KDYHRFFXSLHGWKHSURSHUW\
:HQRWHGWKDWWKHGHSDUWPHQWVDSSHDUHGXQFOHDUUHJDUGLQJH[SHFWDWLRQVRIDFFXUDF\LQWKHXVHRI
,26WKHWLPHOLQHVVRIFRUUHFWLRQVRIPLVWDNHVPDGHLQGDWDHQWU\LQWR,26E\'6'VWDIIDQGWKH
UHVSRQVLELOLW\IRUWKHIROORZXSRIXQSDLG,26IHHV$QRIILFLDODJUHHPHQWEHWZHHQ'6'DQG
3XEOLF8WLOLWLHVZRXOGDOORZIRUHDVLHUPRQLWRULQJRISHUIRUPDQFHDVZHOODVQXOOLI\DQ\TXHVWLRQ
RUGHEDWHRIH[SHFWDWLRQVDQGUHVSRQVLELOLWLHVRIWKHWZRSDUWLHVZKLFKPD\DWWLPHVKDYH
UHVXOWHGLQWKHGLVVDWLVIDFWLRQRIERWKLQWKHSDVW
5HFRPPHQGDWLRQ
'6'DQG3XEOLF8WLOLWLHVVKRXOGFUHDWHDQGPDLQWDLQHLWKHUD6HUYLFH/HYHO$JUHHPHQWRUD
0HPRUDQGXPRI8QGHUVWDQGLQJWKDWIRUPDOO\GHILQHVWKHDJUHHGOHYHORIVHUYLFHEHWZHHQWKH
WZRGHSDUWPHQWV

3RWDEOHZDWHULVGHILQHGDVZDWHU WKDWLVVDIHWRGULQN 3RWDEOHZDWHULVIUHHIURPSROOXWLRQKDUPIXORUJDQLVPVDQG
LPSXULWLHV



   

 

 
   
 


 




 





 
  

  



 
   
 

 




'6'GRHVQRWKDYHIRUPDOZULWWHQSROLFLHVRUSURFHGXUHVIRUWKHFROOHFWLRQRI,26IHHV
$VVWDWHGDERYHRXUWHVWLQJUHYHDOHGVHYHUDOLQVWDQFHVZKHQ'6'LVVXHGSHUPLWVWRFXVWRPHUV
DOWKRXJK,26SHUPLWIHHVKDGQRWEHHQSDLG7KLVLPSOLHVLQWHUQDOFRQWUROZHDNQHVVHVH[LVWDW
RQHRUPRUHSRLQWVGXULQJWKHFROOHFWLRQSURFHVV6SHFLILFDOO\FRQWUROVUHODWHGWR
  &DVKLHUFROOHFWLRQRI,26IHHVDWWKHWLPH376IHHVDUHSDLG
  &DVKLHUXSGDWLQJVWDWXVRIDFFRXQWVLQ,26PDQXDOO\HQWHULQJSD\PHQWLQIRUPDWLRQLQWR
,26DVSD\PHQWVDUHPDGH
&DVKLHUV¶&ROOHFWLRQRI,26)HHV
7KH&DVKLHUVGLYLVLRQSURFHVVHVSHUFHQWRIDOOLQFRPLQJPRQH\IRUWKHGHSDUWPHQWWUDFNLQJ
SD\PHQWVLQ376:KHQSD\PHQWVDUHDFFHSWHGIRU,26LQYRLFHVFDVKLHUVPXVWDFFHVV,26DQG
PDQXDOO\XSGDWHWKHDFFRXQW'6'&DVKLHUVDFFHSWFDVKFUHGLWFDUGVDQGSHUVRQDOFKHFNV
$FFRUGLQJWR'6'¶V6HQLRU&DVKLHUWKH&DVKLHUVGLYLVLRQKDVDQGDGKHUHVWRDSROLFLHVDQG
SURFHGXUHVPDQXDOGHWDLOLQJWKHSURFHGXUHVUHTXLUHGIRU'6'FDVKLHUV (DFKFDVKLHUUHFRQFLOHV
SD\PHQWVPDGHDWWKHLUVWDWLRQVDWWKHHQGRIHDFKGD\DQGWKH6HQLRU&DVKLHUSHUIRUPV
UHFRQFLOLDWLRQRU³FORVHRXW´HDFKPRUQLQJRIWKHSULRUGD\¶VZRUN
+LVWRULFDOO\'6'FDVKLHUVKDYHIRXQGLWGLIILFXOWWRGHWHUPLQHZKHQ,26IHHVDUHGXHDVWKHUH
ZDVQRZD\RIGHWHUPLQLQJ,26IHHVGXHIURPWKH376LQYRLFH3ULRUWR-XO\FXVWRPHUV
ZRXOGEHLVVXHGERWKD376DQGDQ,26LQYRLFHEXWPLJKWRQO\SURGXFHWKH376LQYRLFHIRU
SD\PHQW:KLOH'6'VWDWHVWKDWLWLVUDUHIRU,26LQYRLFHVWRJRXQSDLGZKHQDFXVWRPHUSD\V
WKHLU376LQYRLFHFDVKLHUVZRXOGQRWQHFHVVDULO\NQRZWKDWWKH376LQYRLFHKDGFRUUHVSRQGLQJ
,26IHHVGXH $VWKHUHLVQR,26JHQHUDWHGUHSRUWIRU&DVKLHUVWREDODQFHDJDLQVWLWLVGLIILFXOW
WRYHULI\WKDWDOOSD\PHQWVKDYHEHHQFUHGLWHGLQ,26,Q-XO\'6'LPSOHPHQWHGDQHZ
SUDFWLFHLQZKLFK376LQYRLFHVQRZLQFOXGHDOLQHLWHPZLWK,26IHHVGXHRQWKHSURMHFW
&DVKLHUXSGDWLQJRIDFFRXQWVLQ,26
,I,26SD\PHQWVDUHPDGHEXWDUHQRWDFFXUDWHO\DQGDSSURSULDWHO\XSGDWHGLQ,26,26UHSRUWV
ZLOOHUURQHRXVO\LQGLFDWHWKDWSD\PHQWVKDYHQRWEHHQPDGH,Q2FWREHUWKH&DVKLHUV
GLYLVLRQLQLWLDWHGDSURFHGXUHWRHQVXUHWKDW,26SD\PHQWVDUHPDGHDQGWKDWWKH\DUH
DSSURSULDWHO\UHIOHFWHGLQ,267KHSURFHGXUHUHTXLUHVFDVKLHUVDFFHSWLQJ376LQYRLFHVIRU
SD\PHQWWRORRNIRUWKH,26OLQHLWHPDQGWRKLJKOLJKWWKHOLQHLIIRXQG&DVKLHUVWKHQFRPSDUH
WKHIHHDPRXQWRQWKH376LQYRLFHDQGWKH,26LQYRLFH2QFHSDLGFDVKLHUVXSGDWHWKHDFFRXQW
LQ,26DQGSULQWRXWWKHVFUHHQLQ,26VKRZLQJWKHVWDWXVDV³SDLG´$FRS\RIWKLVVFUHHQSULQW
LVXVHGIRUUHFRQFLOLDWLRQDQGLVPDLQWDLQHGE\WKHGLYLVLRQ:KLOH'6'¶V6HQLRU&DVKLHU
SURYLGHGDQHPDLOGLVVHPLQDWHGWRFDVKLHULQJVWDIIUHJDUGLQJWKHQHZSURFHGXUHZULWWHQ
GHSDUWPHQWDOSURFHGXUHVGRQRWH[LVWDQG'6'PDQDJHPHQWGRHVQRWPRQLWRUWKLVQHZ
SURFHGXUH




  


    



 

 
 
 




 
 
 

 






          
    
               
          
              
    





































5HFRPPHQGDWLRQ
'6'PDQDJHPHQWVKRXOGGHYHORSIRUPDOZULWWHQSROLFLHVDQGSURFHGXUHVUHJDUGLQJWKH
FROOHFWLRQRI,26SHUPLWIHHVWRHQVXUHDSSURSULDWHSD\PHQWVDUHPDGHDQGSD\PHQWLQIRUPDWLRQ
LVWUDQVIHUUHGLQWR,267KHVHSROLFLHVDQGSURFHGXUHVVKRXOGEHPRQLWRUHGE\PDQDJHPHQWIRU
HIIHFWLYHQHVV
'6'ODFNVDSROLF\RUSURFHGXUHWRUHFRYHUWKHLQXQSDLG,26IHHV
:KLOHLWLVOLNHO\WKDWDQXPEHURIIDFWRUVPD\KDYHFRQWULEXWHGWRWKHQXPEHURIDFFRXQWVZLWK
XQSDLG,26IHHVGXULQJWKHWKUHHILVFDO\HDUVUHYLHZHG

WKHQXPEHUWKDWKDVUHPDLQHG
XQUHFRYHUHGLVGXHWRWKHDEVHQFHRIDGHSDUWPHQWDOSROLF\RUSURFHGXUHIRUWKHIROORZXSRI
XQSDLG,26IHHV'XULQJRXUDXGLWUHYLHZSHULRGILVFDO\HDUV'6'KDGQRZULWWHQ
SROLFLHVRUSURFHGXUHVUHJDUGLQJVWHSVWREHWDNHQWRUHFRYHUXQSDLG,26IHHV:KLOH'6'
SURYLGHGVRPHUHFRUGVRIGHOLQTXHQWDFFRXQWVIRUZDUGHGWR&ROOHFWLRQV

IRUUHFRYHU\WKH
GHSDUWPHQWGRHVQRWKDYHDQDXWRPDWLF³GHOLQTXHQF\UXOH´WKDWSURPSWVWKHSURFHVVLQJRIXQSDLG
IHHVWR&ROOHFWLRQV'6'DGYLVHGWKDWWKLVLVEHFDXVHWKHQDWXUHRIWKHV\VWHPPDNHVLWDELWRID
JXHVVLQJJDPHWRPDWFKHQWLWLHVIRUH[DPSOHPXOWLSOHSHRSOHZLWKWKHVDPHQDPH'XULQJWKH
DXGLWSHULRGZKHQWKH,26&RRUGLQDWRUUHOD\HGLQIRUPDWLRQRIGHOLQTXHQWDFFRXQWVWR'6'
VXSHUYLVRUVZRXOGZRUNRQWKHPDVWLPHSHUPLWWHG
$FFRUGLQJWR'6'LWKDVLPSOHPHQWHGSURFHGXUHVIRUWKHFROOHFWLRQRIXQSDLGIHHVHIIHFWLYH
6HSWHPEHU8QGHUWKHVHQHZSURFHGXUHVZKHQWKHGHSDUWPHQWREWDLQVLQIRUPDWLRQ
UHJDUGLQJGHOLQTXHQWDFFRXQWVIURPWKH,26&RRUGLQDWRULWZLOOSODFHDQDGPLQLVWUDWLYHKROGRQ
WKHDFFRXQWLIWKHDFFRXQWLVVWLOODFWLYH,IDSHUPLWKDVDOUHDG\EHHQLVVXHGIRUWKHSURMHFW'6'
ZLOOVHQGDUHJLVWHUHGOHWWHUWRWKHFXVWRPHUQRWLI\LQJWKHPRIWKHRXWVWDQGLQJEDODQFHDQG
UHTXHVWLQJUHVSRQVHDQGRUSD\PHQWZLWKLQZRUNLQJGD\V$WWKHFORVHRIWKHGD\SHULRG
DFFRXQWVDUHFUHDWHGXVLQJWKH&LW\¶V$FFRXQWV5HFHLYDEOH,QIRUPDWLRQ6\VWHP $5,6

 7KH
HQWHULQJRIDFFRXQWLQIRUPDWLRQLQWR$5,6EHJLQVWKHFROOHFWLRQSURFHVV$WWKLVSRLQWHDFK
DFFRXQWLVJLYHQDGD\JUDFHSHULRGGXULQJZKLFKWLPHFXVWRPHUVFDQFRQWDFW'6'UHJDUGLQJ
WKHLUDFFRXQWV$V'6'DQWLFLSDWHVZHHNO\UHSRUWVIURP&ROOHFWLRQVUHJDUGLQJLQYRLFHVWKDWKDYH
EHHQSDLG'6'VWDWHVWKDWLWZRXOGEHDEOHWRXVHWKH$5,6DFFRXQWQXPEHUIRUPRQLWRULQJ
SXUSRVHVRIDFFRXQWUHFRYHU\
3XEOLF8WLOLWLHV¶,26&RRUGLQDWRUPRQLWRUV,26DFFRXQWVDQGSD\PHQWVPDGH$VFXVWRPHU
SD\PHQWVDIIHFWSURYLVLRQRIVHUYLFHVWRFXVWRPHUVLWLVLPSRUWDQWIRU'6'WRVKDUHXSGDWHVRQ
IHHUHFRYHU\ZLWK3XEOLF8WLOLWLHVDVWKHZHHNO\XSGDWHVUHFHLYHGE\'6'IURP&ROOHFWLRQVDUH

7KHVH IDFWRUV VXFK DV D ODFN RI VWDQGDUGL]DWLRQ RI DVVHVVPHQW SURFHGXUHV SHULRGLF WUDLQLQJ DQG V\VWHP
LQWHUIDFLQJZLOOEHDGGUHVVHGODWHULQWKHDXGLWUHSRUW

&ROOHFWLRQVLVDVHFWLRQZLWKLQWKH2IILFHRIWKH&LW\7UHDVXUHU &ROOHFWLRQVLVIRUPDOO\NQRZQDVWKH'HOLQTXHQW
$FFRXQWV3URJUDPDQGLVUHVSRQVLEOHIRUWKHFROOHFWLRQRISDVWGXHDFFRXQWVRZHGWRWKH&LW\

7KH &LW\ RI 6DQ'LHJR LPSOHPHQWHG D QHZ DFFRXQWV UHFHLYDEOH V\VWHP (IIHFWLYH 0DUFK   DQ DFFRXQWV
UHFHLYDEOHPRGXOHRI6$3KDVUHSODFHG$5,6







 
  


 


  



 

 
  
  


   

   
 
 
 




QRWDOVRSURYLGHGWR3XEOLF8WLOLWLHVDQGPRQH\UHFRYHUHGFDQQRWEHWUDFNHGE\WKHRULJLQDO,26
DFFRXQWQXPEHUV
5HFRPPHQGDWLRQ
'6'VKRXOGFRQWLQXHLPSOHPHQWDWLRQRIWKHQHZO\GHYHORSHGUHFRYHU\SUDFWLFHVLQFOXGLQJKRZ
XQSDLGIHHVZLOOEHUHIHUUHGWR&ROOHFWLRQVLQRUGHUWRUHFRXSXQSDLGIHHVZKLOHVKDULQJ
PRQLWRULQJDQGUHFRYHU\LQIRUPDWLRQRIGHOLQTXHQWDFFRXQWVZLWK3XEOLF8WLOLWLHV¶,266HFWLRQ
'6'DQG3XEOLF8WLOLWLHVGRQRWDGHTXDWHO\HQVXUHWKDWXSGDWHGSURFHGXUHVIRUWKH
DVVHVVPHQWRI,26IHHVDUHSURSHUO\GRFXPHQWHGDQGGLVVHPLQDWHGWRDSSURSULDWHVWDII
'6'¶VGHSDUWPHQWDOSROLFLHVDQGSURFHGXUHVVKRXOGEHGHVLJQHGWRHQVXUHDSSURSULDWHDQG
VWDQGDUGL]HGUHYLHZRIEXLOGLQJSODQVE\LWV3ODQ5HYLHZ6SHFLDOLVWVWKURXJKRXWWKHGHSDUWPHQW
3ODQ5HYLHZ6SHFLDOLVWVDUHVWDIIUHVSRQVLEOHIRUWKHUHYLHZRISODQVWKDWUHVXOWLQWKHFKDUJLQJRI
IHHVWRFXVWRPHUV5HJDUGLQJ,26IHHVD3ODQ5HYLHZ6SHFLDOLVWV¶GDWDHQWU\LQWR,26LPSDFWV
QRWRQO\RQHWLPHIHHVVXFKDVFDSDFLW\FKDUJHVDQGZDWHUWDSIHHVEXWRQJRLQJIHHVVXFKDV
IXWXUHZDWHUDQGVHZHUELOOV
'6'PDLQWDLQVDQGVWDIIXWLOL]HVDQXPEHURIPDQXDOVIRUWKHXVHRI,267KH:DWHUDQG6HZHU
,QVWDOODWLRQ2UGHU6\VWHP5HIHUHQFH0DQXDOWKHSULPDU\PDQXDOXVHGE\'6'3ODQ5HYLHZ
6SHFLDOLVWVLVDSDJHPDQXDOWKDWZDVODVWXSGDWHGLQ7KHPDQXDOSURYLGHVVWHSE\
VWHSLQVWUXFWLRQVIRUWKHQDYLJDWLRQRI,26VSHFLILFDOO\KRZDQGZKHQWRDFFHVVYDULRXVVFUHHQV
LQSXWGDWDDQGHQWHUUHLPEXUVDEOHV7KHPDQXDOGRHVQRWKRZHYHULQVWUXFWRQKRZWRDVVHVV
IHHVWKHPVHOYHV:KLOHWKH5HIHUHQFH0DQXDOKDVQRWVHHQDQXSGDWHLQQHDUO\\HDUV'6'
5HYLHZVWDIILQGLFDWHVWKDWWKH,26PDQXDOLVXVHIXOIRUWUDLQLQJDQGRFFDVLRQDOUHIHUHQFHEXWLV
VOLJKWO\RXWGDWHGDQRSLQLRQUHSHDWHGLQUHVSHFWWRRWKHUFRPPRQO\XVHGJXLGHV,QDGGLWLRQ
UHYLHZVWDIIVXJJHVWHGWKDWWUDLQLQJLVQHHGHGRQWKH:DWHU0HWHU'DWD&DUGZKLFKLVXVHGE\
UHYLHZVWDIIWRDVVHVVIHHV
$FFRUGLQJWRD'6'3ODQ5HYLHZ6SHFLDOLVW,,,ZKRKDVEHHQUHYLHZLQJ,26IHHVDW'6'IRU
\HDUVWKHUHDUHLPSRUWDQWXQZULWWHQSURFHGXUHVDQGUXOHVWKDWFRPHDERXWDVLVVXHVDULVH1RQH
RIWKHVHSURFHGXUHVRUUXOHVLVIRUPDOO\UHOD\HGWRVWDII5DWKHUWKH\DUHXVXDOO\HPDLOHGQRWLFHV
RUZRUGRIPRXWKLQVWUXFWLRQV'XHWRWKHODFNRIIRUPDOLW\DQGFODULW\RIKRZWRGHWHUPLQH,26
DVVHVVPHQWVWZRUHYLHZHUVFRXOGOLNHO\DVVHVVGLIIHUHQWIHHVIRUWKHVDPHVHWRISODQV7KH
UHYLHZRIEXLOGLQJSODQVUHVXOWLQJLQIHHDVVHVVPHQWVWR&LW\FXVWRPHUVVKRXOGQRWEHVXEMHFWLYH
3URFHGXUDOFKDQJHVWKDWLPSDFWWKHUHYLHZRISODQVDQGFRQVHTXHQWO\WKHDVVHVVPHQWRIIHHV
VKRXOGEHRIILFLDOO\GLVVHPLQDWHGLQZULWWHQIRUPWRDOO'6'5HYLHZ6SHFLDOLVWV)DLOXUHWR
HIIHFWLYHO\UHOD\LQIRUPDWLRQSXWVWKHGHSDUWPHQWDWULVNRILQFRQVLVWHQF\LQFKDUJLQJIHHV
DFFXUDWHO\




 










    
 

  
 


 


   

 
 





  
 






5HFRPPHQGDWLRQ
'6'PDQDJHPHQWLQFRQMXQFWLRQZLWKWKH3XEOLF8WLOLWLHV¶,266HFWLRQVKRXOGFUHDWHD
FRPPRQUHSRVLWRU\WKDWLVXSGDWHGDVUXOHVRUSURFHGXUHVIRUWKHDVVHVVPHQWRI,26SHUPLWIHHV
DUHFUHDWHGRUFKDQJHG
'6'3ODQ5HYLHZ6SHFLDOLVWVGRQRWUHFHLYHDGHTXDWHWUDLQLQJRQWKHDVVHVVPHQWRI,26
IHHVQRUDUHDVVHVVPHQWVSHULRGLFDOO\UHYLHZHG
6WDQGDUGL]HGWUDLQLQJDQGVXSHUYLVRU\UHYLHZVKHOSWRHQVXUHWKDWRSHUDWLRQVDUHFRQVLVWHQWDQG
DFFXUDWH'6'VXSHUYLVRUVRI3ODQ5HYLHZ6SHFLDOLVWVQHLWKHUSURYLGHSHULRGLFWUDLQLQJRQ
DVVHVVPHQWRI,26IHHVQRUGRWKH\SHULRGLFDOO\UHYLHZWKHIHHDVVHVVPHQWVPDGHE\UHYLHZ
VWDII
$VSUHYLRXVO\VWDWHGWKH,QIRUPDWLRQDQG$SSOLFDWLRQV6HUYLFHVVHFWLRQLVQRWWKHRQO\JURXS RU
FOXVWHU RI3ODQ5HYLHZ6SHFLDOLVWVDW'6'WKDWUHJXODUO\DVVHVVHV,26IHHV 7KHUHDUHILYH
VXSHUYLVRU\FOXVWHUVDW'6'WKUHHRIZKLFKUHJXODUO\DVVHVV,26IHHV7KHWKUHHFOXVWHUVDFFRXQW
IRUVWDIIPHPEHUV7KHODVWIRUPDO,26WUDLQLQJZKLFKRFFXUUHGZKHQWKHODVWJURXSRI3ODQ
5HYLHZ6SHFLDOLVWVZHUHKLUHGLQWRWKHGHSDUWPHQWZDVD\HDUORQJWUDLQLQJIURPPLG
WKURXJK$SSURDFKHVWRHQVXULQJRQJRLQJWUDLQLQJRIVWDIIGLIIHUHGDPRQJWKHWKUHH
FOXVWHUV$FFRUGLQJWRRQHVXSHUYLVRUKLVVWDIIGRHVQRWUHFHLYH,26WUDLQLQJ$VHFRQG
VXSHUYLVRUVWDWHGWKDWWUDLQLQJLVSURYLGHGEHIRUHRQHFDQEHFRPHD3ODQ5HYLHZ6SHFLDOLVW,,,RU
ZKHQVWDIIPDNHVDPLVWDNH$WKLUGVXSHUYLVRUVWDWHGWKHUHLVQRIRUPDOWUDLQLQJEXWWKDWVWDII
UHFHLYHVRQWKHMREWUDLQLQJ
:DWHUDQG6HZHUUHYLHZVZHUHRULJLQDOO\FRQGXFWHGE\DJURXSRIZDWHUDQGVHZHUIHH
VSHFLDOLVWVZKRZHUHDSDUWRIWKH:DWHU'HSDUWPHQW,QWKHODWH¶VWKLVJURXSZDV
UHFODVVLILHGDQGPRYHGWR'6'ZKHUHWKHGHSDUWPHQWPDGHDGHFLVLRQWRFRPELQHWKHVSHFLDOLVWV
ZLWKWKHUHVWRIWKHVWDIIUHVXOWLQJLQUHYLHZVWDIIWKDWDUHUHVSRQVLEOHIRUNQRZLQJKRZWRUHYLHZ
DQXPEHURIVSHFLDOWLHV&XUUHQWO\VWDIILVDOVRUHVSRQVLEOHIRU]RQLQJUHVLGHQWLDOPHFKDQLFDO
DQGVWRUPZDWHUUHTXLUHPHQWUHYLHZV7KHRULJLQDOVSHFLDOLVWVKDYHDOOVLQFHUHWLUHG
$VWUDLQLQJDQGTXDOLILHGWUDLQHUVDUHDOVRVFDUFHSHULRGLFDVVHVVPHQWVRI5HYLHZ6SHFLDOLVWV¶
ZRUNE\VXSHUYLVRUVZRXOGKHOSHQVXUHDFFXUDF\DQGFRQVLVWHQF\DPRQJDVVHVVPHQWV+RZHYHU
RQO\RQHRIWKHWKUHHVXSHUYLVRUVRIVWDIIWKDWUHJXODUO\DVVHVV,26IHHVFRQGXFWVSHULRGLFUHYLHZV
RIVWDIIDVVHVVPHQWV$QRWKHUVXSHUYLVRUVWDWHGWKDWSHULRGLFUHYLHZVRIVWDIIDUHQRWFRQGXFWHG
DVVRPHVWDIIPHPEHUVKDYHEHHQFRQGXFWLQJUHYLHZVIRUPRUHWKDQ\HDUV$FFRUGLQJWR
3XEOLF8WLOLWLHV'6'VWDIIZKRDVVHVVSODQVDUHPDNLQJWKHVDPHPLVWDNHVUHSHDWHGO\ 2XU
UHYLHZRIILVFDO\HDU,26$GPLQLVWUDWLYH+ROGVUHSRUWVVKRZHGEHWZHHQWR



 








 

 


  


  



 

 


 


             
     
              
      

























DFFRXQWVOLVWHGHDFKUHSRUWLQJSHULRG

$GPLQLVWUDWLYH+ROGVFDQEHSODFHGRQ1664DFFRXQWV
LQ,26E\3XEOLF8WLOLWLHVDQGRQ376DFFRXQWVE\'6':KHQ3XEOLF8WLOLWLHV¶,26
&RRUGLQDWRUSODFHVDKROGRQDQDFFRXQWLQ,26'6'LVQRWLILHGDQGUHTXHVWHGWRSODFHDKROGLQ
376XQWLOFRUUHFWLRQVFDQEHPDGH

5HFRPPHQGDWLRQ
'6'VKRXOGLPSOHPHQWDSHULRGLFUHYLHZRISODQVLQ6XSHUYLVRU\&OXVWHUVWKDWUHJXODUO\DVVHVV
,26IHHVDQG\HDUO\WUDLQLQJVHVVLRQVLQFRQMXQFWLRQZLWK3XEOLF8WLOLWLHV
$GGLWLRQDOLQWHUIDFLQJEHWZHHQ'6'¶V3URMHFW7UDFNLQJ6\VWHP 376 DQG3XEOLF8WLOLWLHV¶
,QVWDOODWLRQ2UGHULQJ6\VWHP ,26 UHSODFHPHQWDSSOLFDWLRQZLOOUHVXOWLQLQFUHDVHG
HIILFLHQF\DQGUHGXFHGHUURU
6WUHDPOLQLQJDQGDXWRPDWLQJSURFHVVHVLVRSWLPDOIRUGHSDUWPHQWVZLWKRYHUODSSLQJRUUHGXQGDQW
V\VWHPSURFHVVHVWKDWKDQGOHKLJKQXPEHUVRIFXVWRPHUV7KHVHSUDFWLFHVPRVWRIWHQUHVXOWLQ
OHVVHUURUWKDQPDQXDOSURFHVVHVDVZHOODVDJUHDWHUIORZRILQIRUPDWLRQ$VVWDWHGSUHYLRXVO\
'6'3ODQ5HYLHZ6SHFLDOLVWVDQG&DVKLHUVXVH,26GXULQJWKHSURFHVVRIDVVHVVLQJDQG
FROOHFWLQJ,26IHHV3XEOLF8WLOLWLHVXVHV,26WRGHWHUPLQHIXWXUHZDWHUDQGVHZHUQHHGVDVZHOO
DVWRPRQLWRUH[SHFWHGUHYHQXHIRUWKHGHSDUWPHQWDQGIRUWKH&RXQW\:DWHU$XWKRULW\
'6'¶V3URMHFW7UDFNLQJ6\VWHP 376 DQG3XEOLF8WLOLWLHV¶,QVWDOODWLRQ2UGHU6\VWHP ,26 DUH
QRWDGHTXDWHO\LQWHUIDFHG'6'VWDIIPDQXDOO\HQWHUVUHGXQGDQWLQIRUPDWLRQLQERWK376DQG
,267KLVGXSOLFDWLRQRIGDWDHQWU\FUHDWHVDULVNRIHUURUZKLFKRYHUWKHILVFDO\HDUVUHYLHZHG
KDVOLNHO\FRVWERWK'6'DQG3XEOLF8WLOLWLHVKRXUVRIODERUWRLGHQWLI\DQGFRUUHFW
&XUUHQWO\DQHOHFWURQLFLQWHUIDFHH[LVWVEHWZHHQWKH376 ,26DSSOLFDWLRQVWUDQVIHUULQJRQO\
WKHFXUUHQWSURMHFWVWDWXVIURP'6'¶V376WR3XEOLF8WLOLWLHV¶,26DSSOLFDWLRQ7KLVSHUPLW
VWDWXVDOORZV,26WRGHWHUPLQHZKHQDIHHVKRXOGKDYHEHHQFROOHFWHG7KLVLQIRUPDWLRQLVWKHQ
XVHGWRFUHDWHDPRQWKO\³,269DULDQFH5HSRUW´FRPSULVHGRIFXPXODWLYHIHHVGXHEXWQRW
FROOHFWHG,QWKHSDVWWKHUHKDYHEHHQFXPXODWLYHYDULDQFHVRIRYHUPLOOLRQGROODUVEHWZHHQ
WKHWZRV\VWHPV
'6'SROLF\VWDWHVWKDW376LQYRLFHVPXVWEHSDLGLQIXOOSDUWLDOSD\PHQWVDUHQRWSHUPLWWHG$V
,26IHHVKDYHQRZEHHQDGGHGWR376LQYRLFHVERWK,26DQG376LQYRLFHVPXVWEHSDLGZKHQ
FXVWRPHUVPDNHSD\PHQWVWRWKH'6'¶V&DVKLHUVGLYLVLRQ7KHUHIRUHDGGLQJDQDGGLWLRQDO
LQWHUIDFHWRDOORZDQRYHUQLJKWXSGDWHIURP376WR,26RI376DFFRXQWVWKDWKDYHEHHQSDLGLQ
IXOO

ZRXOGUHOHDVHFDVKLHUVWDIIIURPWLPHFRQVXPLQJSURFHGXUHVZKLOHHQVXULQJWKDW,26

5HSRUWVDUHJHQHUDWHGRQDPRQWKO\EDVLV $QXPEHURIDFFRXQWVUHPDLQRQWKH $GPLQLVWUDWLYH+ROGVUHSRUWIRU
PRQWKV\HDUV 7KHUHIRUHGXSOLFDWLRQVZLWKLQWRWDOQXPEHUVH[LVW

$GPLQLVWUDWLYH+ROGVDUHSODFHGIRUDQXPEHURIUHDVRQVLQFOXGLQJIHHVGXHRUUHIXQGVGXHRQDQDFFRXQW

,26DFFRXQWVDOVROLVWWKHFRUUHVSRQGLQJ376SURMHFWQXPEHUZKHQDSSOLFDEOH




 







  





  





 







LQYRLFHVDUHSDLG,QWHUIDFLQJZRXOGDOVRVDYH'6'3ODQ5HYLHZ6WDIIWLPHLQUHYLHZLQJ
DFFRXQWVLGHQWLILHGE\WKH,26&RRUGLQDWRUDVQRWKDYLQJEHHQSDLGDVZHOODVHOLPLQDWHWLPH
VSHQWE\'6'PDQDJHPHQWLQFROOHFWLQJXQSDLG,26IHHV
+RZHYHUFUHDWLQJDGGLWLRQDOLQWHUIDFHVEHWZHHQWKHFXUUHQWV\VWHPVDWWKLVSRLQWZLOOSURYLGH
GLPLQLVKLQJUHWXUQVDV3XEOLF8WLOLWLHVLVLQWKHSURFHVVRILPSOHPHQWLQJ6$3WRUHSODFH,26DQG
&,6 3XEOLF8WLOLWLHV¶&XVWRPHU,QIRUPDWLRQ6\VWHP 3XEOLF8WLOLWLHVSODQVRQUHYLHZLQJ
SRVVLEOHLQWHUIDFHVEHWZHHQ6$3DQG376GXULQJWKHEOXHSULQWLQJSURFHVVIRUWKH,26
UHSODFHPHQW6$3FRPSRQHQWIROORZLQJEHVWEXVLQHVVSUDFWLFH
5HFRPPHQGDWLRQ
3XEOLF8WLOLWLHVVKRXOGZRUNZLWKLPSOHPHQWDWLRQFRQVXOWDQWVDVSODQQHGWRHQVXUHPD[LPXP
HIILFLHQFLHVDUHJDLQHGWKURXJKLQWHUIDFLQJZLWKDOOSURFHVVUHODWHGDSSOLFDWLRQVLQFOXGLQJ
'HYHORSPHQW6HUYLFHV'HSDUWPHQW¶V '6' 3URMHFW7UDFNLQJ6\VWHP'6'VKRXOGEHLQFOXGHG
RQWKHUHODWLYHLQWHUIDFHVDQGIDFLOLWDWHDXWRPDWHGGDWDLQWHUIDFLQJDVUHFRPPHQGHGDQGUHTXLUHG
E\WKHLPSOHPHQWLQJFRQVXOWDQW
&21&/86,21
7KHDVVHVVPHQWDQGFROOHFWLRQRIIHHVE\'6'LVDYLWDOVHUYLFHWRWKH&LW\RI6DQ'LHJR:H
IRXQGDQXPEHURIZHDNLQWHUQDOFRQWUROVLQWKHSURFHVVHVUHODWHGWRWKHFKDUJLQJDQGWKH
FROOHFWLQJRI,26IHHVLQUHODWLRQWRWKH3XEOLF8WLOLWLHV'HSDUWPHQWZKLFKSURYLGHVDFFHVVWRWKH
&LW\¶VZDWHUPDLQDQGVHZHUODWHUDOVUHVXOWLQJLQDQXQFROOHFWHGDPRXQWIRU3XEOLF8WLOLWLHV
WRWDOLQJDVRI'6'DGYLVHGWKDWLWKDVLPSOHPHQWHGDQXPEHURIQHZ
SUDFWLFHVDQGSURFHGXUHVWRVWUHQJWKHQWKHLUSHUPLWWLQJSURFHVVDQGOHVVHQWKHOLNHOLKRRGRI
XQSDLG,26IHHVRQDFWLYHDFFRXQWV,QSUHVHQWLQJWKLVDXGLWDQGLWVUHFRPPHQGDWLRQVZHKRSH
WRVWUHQJWKHQWKHSHUPLWWLQJSURFHVVDQGHQVXUHDFFXUDWHDQGFRQVLVWHQWUHYLHZDQGFROOHFWLRQRI
IHHVIRUWKH&LW\

Attachment A
THE
THE
THE
THE
THE
THE
THE
THE
THE
CITY
CITY
CITY
CITY
CITY
CITY
CITY
CITY
CITY
OF
OF
OF
OF
OF
OF
OF
OF
OF
SAN
SAN
SAN
SAN
SAN
SAN
SAN
SAN
SAN
DIEGO
DIEGO
DIEGO
DIEGO
DIEGO
DIEGO
DIEGO
DIEGO
DIEGO
MEMORANDUM
MEMORANDUM
MEMORANDUM
MEMORANDUM
MEMORANDUM
MEMORANDUM
MEMORANDUM
MEMORANDUM
MEMORANDUM
DATE:
DATE:
DATE:
DATE:
DATE:
DATE:
DATE:
DATE:
DATE:
June
June
June
June
June
June
June
June
June 18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
TO:
TO:
TO:
TO:
TO:
TO:
TO:
TO:
TO:
Eduardo
Eduardo
Eduardo
Eduardo
Eduardo
Eduardo
Eduardo
Eduardo
Eduardo
Luna,
Luna,
Luna,
Luna,
Luna,
Luna,
Luna,
Luna,
Luna,
City
City
City
City
City
City
City
City
City
Auditor
Auditor
Auditor
Auditor
Auditor
Auditor
Auditor
Auditor
Auditor
FROM:
FROM:
FROM:
FROM:
FROM:
FROM:
FROM:
FROM:
FROM:
Kelly
Kelly
Kelly
Kelly
Kelly
Kelly
Kelly
Kelly
Kelly Broughton,
Broughton,
Broughton,
Broughton,
Broughton,
Broughton,
Broughton,
Broughton,
Broughton, Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services Department
Department
Department
Department
Department
Department
Department
Department
Department Director
Director
Director
Director
Director
Director
Director
Director
Director
Alex
Alex
Alex
Alex
Alex
Alex
Alex
Alex
Alex
Ruiz,
Ruiz,
Ruiz,
Ruiz,
Ruiz,
Ruiz,
Ruiz,
Ruiz,
Ruiz, Acting
Acting
Acting
Acting
Acting
Acting
Acting
Acting
Acting Public
Public
Public
Public
Public
Public
Public
Public
Public
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities Department
Department
Department
Department
Department
Department
Department
Department
Department
Director
Director
Director
Director
Director
Director
Director
Director
Director
SUBJECT:
SUBJECT:
SUBJECT:
SUBJECT:
SUBJECT:
SUBJECT:
SUBJECT:
SUBJECT:
SUBJECT:
Response
Response
Response
Response
Response
Response
Response
Response
Response to
to
to
to
to
to
to
to
to the
the
the
the
the
the
the
the
the Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit of
of
of
of
of
of
of
of
of
the
the
the
the
the
the
the
the
the Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services Department
Department
Department
Department
Department
Department
Department
Department
Department
Water
Water
Water
Water
Water
Water
Water
Water
Water and
and
and
and
and
and
and
and
and
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Fees
Fees
Fees
Fees
Fees
Fees
Fees
Fees
Fees
(lOS
(lOS
(lOS
(lOS
(lOS
(lOS
(lOS
(lOS
(lOS
Fees)
Fees)
Fees)
Fees)
Fees)
Fees)
Fees)
Fees)
Fees)
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection Process
Process
Process
Process
Process
Process
Process
Process
Process
The
The
The
The
The
The
The
The
The Development
Development
Development
Development
Development
Development
Development
Development
Development
Services
Services
Services
Services
Services
Services
Services
Services
Services Department
Department
Department
Department
Department
Department
Department
Department
Department and
and
and
and
and
and
and
and
and
Public
Public
Public
Public
Public
Public
Public
Public
Public
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities Department
Department
Department
Department
Department
Department
Department
Department
Department
have
have
have
have
have
have
have
have
have reviewed
reviewed
reviewed
reviewed
reviewed
reviewed
reviewed
reviewed
reviewed
the
the
the
the
the
the
the
the
the audit.
audit.
audit.
audit.
audit.
audit.
audit.
audit.
audit.
The
The
The
The
The
The
The
The
The audit
audit
audit
audit
audit
audit
audit
audit
audit used
used
used
used
used
used
used
used
used
Installation
Installation
Installation
Installation
Installation
Installation
Installation
Installation
Installation Order
Order
Order
Order
Order
Order
Order
Order
Order System
System
System
System
System
System
System
System
System (lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
reports
reports
reports
reports
reports
reports
reports
reports
reports
for
for
for
for
for
for
for
for
for Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal Years
Years
Years
Years
Years
Years
Years
Years
Years
2007-2009
2007-2009
2007-2009
2007-2009
2007-2009
2007-2009
2007-2009
2007-2009
2007-2009 and
and
and
and
and
and
and
and
and
used
used
used
used
used
used
used
used
used
the
the
the
the
the
the
the
the
the
end
end
end
end
end
end
end
end
end
date
date
date
date
date
date
date
date
date of
of
of
of
of
of
of
of
of
June
June
June
June
June
June
June
June
June 30,
30,
30,
30,
30,
30,
30,
30,
30, 2009
2009
2009
2009
2009
2009
2009
2009
2009
as
as
as
as
as
as
as
as
as the
the
the
the
the
the
the
the
the end
end
end
end
end
end
end
end
end
of
of
of
of
of
of
of
of
of
the
the
the
the
the
the
the
the
the time
time
time
time
time
time
time
time
time period
period
period
period
period
period
period
period
period audited
audited
audited
audited
audited
audited
audited
audited
audited (end
(end
(end
(end
(end
(end
(end
(end
(end of
of
of
of
of
of
of
of
of
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal Year
Year
Year
Year
Year
Year
Year
Year
Year 2009).
2009).
2009).
2009).
2009).
2009).
2009).
2009).
2009).
As
As
As
As
As
As
As
As
As the
the
the
the
the
the
the
the
the audit
audit
audit
audit
audit
audit
audit
audit
audit notes,
notes,
notes,
notes,
notes,
notes,
notes,
notes,
notes, as
as
as
as
as
as
as
as
as of
of
of
of
of
of
of
of
of
June
June
June
June
June
June
June
June
June 30,
30,
30,
30,
30,
30,
30,
30,
30, 2009,
2009,
2009,
2009,
2009,
2009,
2009,
2009,
2009, the
the
the
the
the
the
the
the
the lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
system
system
system
system
system
system
system
system
system report
report
report
report
report
report
report
report
report showed
showed
showed
showed
showed
showed
showed
showed
showed 120
120
120
120
120
120
120
120
120 lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS New
New
New
New
New
New
New
New
New
Service
Service
Service
Service
Service
Service
Service
Service
Service
Sequence
Sequence
Sequence
Sequence
Sequence
Sequence
Sequence
Sequence
Sequence Requests
Requests
Requests
Requests
Requests
Requests
Requests
Requests
Requests
(NSSQs)
(NSSQs)
(NSSQs)
(NSSQs)
(NSSQs)
(NSSQs)
(NSSQs)
(NSSQs)
(NSSQs)
that
that
that
that
that
that
that
that
that
had
had
had
had
had
had
had
had
had not
not
not
not
not
not
not
not
not
been
been
been
been
been
been
been
been
been
paid
paid
paid
paid
paid
paid
paid
paid
paid
with
with
with
with
with
with
with
with
with the
the
the
the
the
the
the
the
the total
total
total
total
total
total
total
total
total
amount
amount
amount
amount
amount
amount
amount
amount
amount
owed
owed
owed
owed
owed
owed
owed
owed
owed
to
to
to
to
to
to
to
to
to
the
the
the
the
the
the
the
the
the City
City
City
City
City
City
City
City
City
being
being
being
being
being
being
being
being
being
$1,338,036.
$1,338,036.
$1,338,036.
$1,338,036.
$1,338,036.
$1,338,036.
$1,338,036.
$1,338,036.
$1,338,036.
The
The
The
The
The
The
The
The
The audit
audit
audit
audit
audit
audit
audit
audit
audit concludes
concludes
concludes
concludes
concludes
concludes
concludes
concludes
concludes that
that
that
that
that
that
that
that
that in
in
in
in
in
in
in
in
in
reality,
reality,
reality,
reality,
reality,
reality,
reality,
reality,
reality,
65
65
65
65
65
65
65
65
65
of
of
of
of
of
of
of
of
of
the
the
the
the
the
the
the
the
the
120
120
120
120
120
120
120
120
120
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs originally
originally
originally
originally
originally
originally
originally
originally
originally
reported
reported
reported
reported
reported
reported
reported
reported
reported
had
had
had
had
had
had
had
had
had
been
been
been
been
been
been
been
been
been
paid
paid
paid
paid
paid
paid
paid
paid
paid
and
and
and
and
and
and
and
and
and 55
55
55
55
55
55
55
55
55
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs had
had
had
had
had
had
had
had
had not
not
not
not
not
not
not
not
not
been
been
been
been
been
been
been
been
been
paid
paid
paid
paid
paid
paid
paid
paid
paid with
with
with
with
with
with
with
with
with
the
the
the
the
the
the
the
the
the total
total
total
total
total
total
total
total
total amount
amount
amount
amount
amount
amount
amount
amount
amount owed
owed
owed
owed
owed
owed
owed
owed
owed to
to
to
to
to
to
to
to
to
the
the
the
the
the
the
the
the
the City
City
City
City
City
City
City
City
City
being
being
being
being
being
being
being
being
being
$171,342
$171,342
$171,342
$171,342
$171,342
$171,342
$171,342
$171,342
$171,342
as
as
as
as
as
as
as
as
as
of
of
of
of
of
of
of
of
of
June
June
June
June
June
June
June
June
June 30,2009.
30,2009.
30,2009.
30,2009.
30,2009.
30,2009.
30,2009.
30,2009.
30,2009.
These
These
These
These
These
These
These
These
These
results,
results,
results,
results,
results,
results,
results,
results,
results, however,
however,
however,
however,
however,
however,
however,
however,
however, should
should
should
should
should
should
should
should
should
be
be
be
be
be
be
be
be
be
put
put
put
put
put
put
put
put
put
in
in
in
in
in
in
in
in
in perspective.
perspective.
perspective.
perspective.
perspective.
perspective.
perspective.
perspective.
perspective.
As
As
As
As
As
As
As
As
As the
the
the
the
the
the
the
the
the
audit
audit
audit
audit
audit
audit
audit
audit
audit notes,
notes,
notes,
notes,
notes,
notes,
notes,
notes,
notes,
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services
staff
staff
staff
staff
staff
staff
staff
staff
staff
issued
issued
issued
issued
issued
issued
issued
issued
issued approximately
approximately
approximately
approximately
approximately
approximately
approximately
approximately
approximately
24,000
24,000
24,000
24,000
24,000
24,000
24,000
24,000
24,000 building
building
building
building
building
building
building
building
building
permits
permits
permits
permits
permits
permits
permits
permits
permits In
In
In
In
In
In
In
In
In Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Fiscal
Years
Years
Years
Years
Years
Years
Years
Years
Years
2007-2009.
2007-2009.
2007-2009.
2007-2009.
2007-2009.
2007-2009.
2007-2009.
2007-2009.
2007-2009.
During
During
During
During
During
During
During
During
During
this
this
this
this
this
this
this
this
this
same
same
same
same
same
same
same
same
same
time
time
time
time
time
time
time
time
time
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services staff
staff
staff
staff
staff
staff
staff
staff
staff
set
set
set
set
set
set
set
set
set
up
up
up
up
up
up
up
up
up
14,014
14,014
14,014
14,014
14,014
14,014
14,014
14,014
14,014 lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs and
and
and
and
and
and
and
and
and collected
collected
collected
collected
collected
collected
collected
collected
collected $170.744
$170.744
$170.744
$170.744
$170.744
$170.744
$170.744
$170.744
$170.744 million
million
million
million
million
million
million
million
million
in
in
in
in
in
in
in
in
in
water
water
water
water
water
water
water
water
water
and
and
and
and
and
and
and
and
and
sewer
sewer
sewer
sewer
sewer
sewer
sewer
sewer
sewer
fees.
fees.
fees.
fees.
fees.
fees.
fees.
fees.
fees.
Put
Put
Put
Put
Put
Put
Put
Put
Put
in
in
in
in
in
in
in
in
in
perspective,
perspective,
perspective,
perspective,
perspective,
perspective,
perspective,
perspective,
perspective, DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD staff
staff
staff
staff
staff
staff
staff
staff
staff
during
during
during
during
during
during
during
during
during this
this
this
this
this
this
this
this
this
audit
audit
audit
audit
audit
audit
audit
audit
audit
period
period
period
period
period
period
period
period
period
had
had
had
had
had
had
had
had
had
an
an
an
an
an
an
an
an
an
error
error
error
error
error
error
error
error
error
rate
rate
rate
rate
rate
rate
rate
rate
rate
less
less
less
less
less
less
less
less
less
than
than
than
than
than
than
than
than
than
0.4%
0.4%
0.4%
0.4%
0.4%
0.4%
0.4%
0.4%
0.4%
(number
(number
(number
(number
(number
(number
(number
(number
(number of
of
of
of
of
of
of
of
of
errors
errors
errors
errors
errors
errors
errors
errors
errors made
made
made
made
made
made
made
made
made
divided
divided
divided
divided
divided
divided
divided
divided
divided by
by
by
by
by
by
by
by
by
total
total
total
total
total
total
total
total
total lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs
NSSQs created).
created).
created).
created).
created).
created).
created).
created).
created).
Their
Their
Their
Their
Their
Their
Their
Their
Their
error
error
error
error
error
error
error
error
error
rate
rate
rate
rate
rate
rate
rate
rate
rate in
in
in
in
in
in
in
in
in
amount
amount
amount
amount
amount
amount
amount
amount
amount collected
collected
collected
collected
collected
collected
collected
collected
collected is
is
is
is
is
is
is
is
is 0.1
0.1
0.1
0.1
0.1
0.1
0.1
0.1
0.1 %
%
%
%
%
%
%
%
% (amount
(amount
(amount
(amount
(amount
(amount
(amount
(amount
(amount
uncollected
uncollected
uncollected
uncollected
uncollected
uncollected
uncollected
uncollected
uncollected divided
divided
divided
divided
divided
divided
divided
divided
divided by
by
by
by
by
by
by
by
by
total
total
total
total
total
total
total
total
total amount
amount
amount
amount
amount
amount
amount
amount
amount collected).
collected).
collected).
collected).
collected).
collected).
collected).
collected).
collected).
The
The
The
The
The
The
The
The
The two
two
two
two
two
two
two
two
two
Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments take
take
take
take
take
take
take
take
take these
these
these
these
these
these
these
these
these
matters
matters
matters
matters
matters
matters
matters
matters
matters
seriously.
seriously.
seriously.
seriously.
seriously.
seriously.
seriously.
seriously.
seriously.
As
As
As
As
As
As
As
As
As
the
the
the
the
the
the
the
the
the audit
audit
audit
audit
audit
audit
audit
audit
audit
notes,
notes,
notes,
notes,
notes,
notes,
notes,
notes,
notes,
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services
staff
staff
staff
staff
staff
staff
staff
staff
staff
had
had
had
had
had
had
had
had
had
already
already
already
already
already
already
already
already
already
been
been
been
been
been
been
been
been
been
working
working
working
working
working
working
working
working
working
on
on
on
on
on
on
on
on
on
improvements
improvements
improvements
improvements
improvements
improvements
improvements
improvements
improvements to
to
to
to
to
to
to
to
to
the
the
the
the
the
the
the
the
the lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fee
fee
fee
fee
fee
fee
fee
fee
fee process
process
process
process
process
process
process
process
process prior
prior
prior
prior
prior
prior
prior
prior
prior
to
to
to
to
to
to
to
to
to
this
this
this
this
this
this
this
this
this audit
audit
audit
audit
audit
audit
audit
audit
audit period
period
period
period
period
period
period
period
period
and
and
and
and
and
and
and
and
and prior
prior
prior
prior
prior
prior
prior
prior
prior
to
to
to
to
to
to
to
to
to the
the
the
the
the
the
the
the
the Water
Water
Water
Water
Water
Water
Water
Water
Water
and
and
and
and
and
and
and
and
and Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Fee
Fee
Fee
Fee
Fee
Fee
Fee
Fee
Fee Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection Process
Process
Process
Process
Process
Process
Process
Process
Process audit's
audit's
audit's
audit's
audit's
audit's
audit's
audit's
audit's
inception.
inception.
inception.
inception.
inception.
inception.
inception.
inception.
inception.
At
At
At
At
At
At
At
At
At about
about
about
about
about
about
about
about
about the
the
the
the
the
the
the
the
the
same
same
same
same
same
same
same
same
same
time
time
time
time
time
time
time
time
time as
as
as
as
as
as
as
as
as
this
this
this
this
this
this
this
this
this audit
audit
audit
audit
audit
audit
audit
audit
audit began,
began,
began,
began,
began,
began,
began,
began,
began,
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services believes
believes
believes
believes
believes
believes
believes
believes
believes the
the
the
the
the
the
the
the
the improvements
improvements
improvements
improvements
improvements
improvements
improvements
improvements
improvements it
it
it
it
it
it
it
it
it
had
had
had
had
had
had
had
had
had implemented
implemented
implemented
implemented
implemented
implemented
implemented
implemented
implemented
working
working
working
working
working
working
working
working
working with
with
with
with
with
with
with
with
with Public
Public
Public
Public
Public
Public
Public
Public
Public Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
staff
staff
staff
staff
staff
staff
staff
staff
staff
had
had
had
had
had
had
had
had
had reduced
reduced
reduced
reduced
reduced
reduced
reduced
reduced
reduced the
the
the
the
the
the
the
the
the uncollected/not
uncollected/not
uncollected/not
uncollected/not
uncollected/not
uncollected/not
uncollected/not
uncollected/not
uncollected/not referred
referred
referred
referred
referred
referred
referred
referred
referred to
to
to
to
to
to
to
to
to
collection
collection
collection
collection
collection
collection
collection
collection
collection amount
amount
amount
amount
amount
amount
amount
amount
amount
to
to
to
to
to
to
to
to
to
less
less
less
less
less
less
less
less
less
than
than
than
than
than
than
than
than
than
and
$22,000
$22,000
$22,000
$22,000
$22,000
$22,000
$22,000
$22,000 and
and
and
and
and
and
and
and significantly
significantly
significantly
significantly
significantly
significantly
significantly
significantly
significantly addressed
addressed
addressed
addressed
addressed
addressed
addressed
addressed
addressed the
the
the
the
the
the
the
the
the error
error
error
error
error
error
error
error
error problems
problems
problems
problems
problems
problems
problems
problems
problems that
that
that
that
that
that
that
that
that
occurred
occurred
occurred
occurred
occurred
occurred
occurred
occurred
occurred in
in
in
in
in
in
in
in
in
prior
prior
prior
prior
prior
prior
prior
prior
prior years.
years.
years.
years.
years.
years.
years.
years.
years.
$22;000
No
No
No
No
No
No
No
No
No matter
matter
matter
matter
matter
matter
matter
matter
matter
how
how
how
how
how
how
how
how
how
much
much
much
much
much
much
much
much
much standardization
standardization
standardization
standardization
standardization
standardization
standardization
standardization
standardization or
or
or
or
or
or
or
or
or integration
integration
integration
integration
integration
integration
integration
integration
integration
is
is
is
is
is
is
is
is
is incorporated
incorporated
incorporated
incorporated
incorporated
incorporated
incorporated
incorporated
incorporated into
into
into
into
into
into
into
into
into
any
any
any
any
any
any
any
any
any accounting
accounting
accounting
accounting
accounting
accounting
accounting
accounting
accounting
transaction
transaction
transaction
transaction
transaction
transaction
transaction
transaction
transaction process
process
process
process
process
process
process
process
process and
and
and
and
and
and
and
and
and
system,
system,
system,
system,
system,
system,
system,
system,
system,
there
there
there
there
there
there
there
there
there will
will
will
will
will
will
will
will
will
always
always
always
always
always
always
always
always
always
be
be
be
be
be
be
be
be
be
labor
labor
labor
labor
labor
labor
labor
labor
labor inefficiencies
inefficiencies
inefficiencies
inefficiencies
inefficiencies
inefficiencies
inefficiencies
inefficiencies
inefficiencies and
and
and
and
and
and
and
and
and
errors
errors
errors
errors
errors
errors
errors
errors
errors when
when
when
when
when
when
when
when
when
processing
processing
processing
processing
processing
processing
processing
processing
processing large
large
large
large
large
large
large
large
large amounts
amounts
amounts
amounts
amounts
amounts
amounts
amounts
amounts
of
of
of
of
of
of
of
of
of
transactions
transactions
transactions
transactions
transactions
transactions
transactions
transactions
transactions in
in
in
in
in
in
in
in
in
multiple
multiple
multiple
multiple
multiple
multiple
multiple
multiple
multiple locations.
locations.
locations.
locations.
locations.
locations.
locations.
locations.
locations.
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services and
and
and
and
and
and
and
and
and
Attachment A
Department
Department
Department
Department
Department
Department
Department
Department
Department
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Water
Water
Water
Water
Water
Water
Water
Water
Water and
and
and
and
and
and
and
and
and Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer Permit
Permit
Permit
Permit
Permit
Permit
Permit
Permit
Permit Fees
Fees
Fees
Fees
Fees
Fees
Fees
Fees
Fees
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection Process
Process
Process
Process
Process
Process
Process
Process
Process Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
June
June
June
June
June
June
June
June
June 18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
Public
Public
Public
Public
Public
Public
Public
Public
Public
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
staff
staff
staff
staff
staff
staff
staff
staff
staff
do
do
do
do
do
do
do
do
do
a
a
a
a
a
a
a
a
a
great
great
great
great
great
great
great
great
great job
job
job
job
job
job
job
job
job in
in
in
in
in
in
in
in
in
an
an
an
an
an
an
an
an
an
extremely
extremely
extremely
extremely
extremely
extremely
extremely
extremely
extremely complex
complex
complex
complex
complex
complex
complex
complex
complex
environment
environment
environment
environment
environment
environment
environment
environment
environment and
and
and
and
and
and
and
and
and should
should
should
should
should
should
should
should
should be
be
be
be
be
be
be
be
be
acknowledged
acknowledged
acknowledged
acknowledged
acknowledged
acknowledged
acknowledged
acknowledged
acknowledged
for
for
for
for
for
for
for
for
for
their
their
their
their
their
their
their
their
their hard
hard
hard
hard
hard
hard
hard
hard
hard work
work
work
work
work
work
work
work
work and
and
and
and
and
and
and
and
and dedication.
dedication.
dedication.
dedication.
dedication.
dedication.
dedication.
dedication.
dedication.
Recommendations
RecommendationsRecommendations
Recommendations
Recommendations
Recommendations
Recommendations
Recommendations
Recommendations
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
#1:
#1:
#1:
#1:
#1:
#1:
#1:
#1:
#1: 
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD should
should
should
should
should
should
should
should
should revise
revise
revise
revise
revise
revise
revise
revise
revise its
its
its
its
its
its
its
its
its
collection
collection
collection
collection
collection
collection
collection
collection
collection processes
processes
processes
processes
processes
processes
processes
processes
processes to
to
to
to
to
to
to
to
to
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure that
that
that
that
that
that
that
that
that
building
building
building
building
building
building
building
building
building
permits
permits
permits
permits
permits
permits
permits
permits
permits and
and
and
and
and
and
and
and
and certificates
certificates
certificates
certificates
certificates
certificates
certificates
certificates
certificates of
of
of
of
of
of
of
of
of 
occupancy
occupancy
occupancy
occupancy
occupancy
occupancy
occupancy
occupancy
occupancy
are
are
are
are
are
are
are
are
are not
not
not
not
not
not
not
not
not being
being
being
being
being
being
being
being
being issued
issued
issued
issued
issued
issued
issued
issued
issued to
to
to
to
to
to
to
to
to
customers
customers
customers
customers
customers
customers
customers
customers
customers prior
prior
prior
prior
prior
prior
prior
prior
prior
to
to
to
to
to
to
to
to
to
full
full
full
full
full
full
full
full
full
payment
payment
payment
payment
payment
payment
payment
payment
payment of
of
of
of
of
of
of
of
of
all
all
all
all
all
all
all
all
all
development
development
development
development
development
development
development
development
development fees
fees
fees
fees
fees
fees
fees
fees
fees 
including
including
including
including
including
including
including
including
including water
water
water
water
water
water
water
water
water
fees.
fees.
fees.
fees.
fees.
fees.
fees.
fees.
fees. 
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response: 
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree with
with
with
with
with
with
with
with
with the
the
the
the
the
the
the
the
the recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
The
The
The
The
The
The
The
The
The revisions
revisions
revisions
revisions
revisions
revisions
revisions
revisions
revisions to
to
to
to
to
to
to
to
to
the
the
the
the
the
the
the
the
the collection
collection
collection
collection
collection
collection
collection
collection
collection
process
process
process
process
process
process
process
process
process are
are
are
are
are
are
are
are
are
completed.
completed.
completed.
completed.
completed.
completed.
completed.
completed.
completed.
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation #2:
#2:
#2:
#2:
#2:
#2:
#2:
#2:
#2: 
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD and
and
and
and
and
and
and
and
and Public
Public
Public
Public
Public
Public
Public
Public
Public Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities should
should
should
should
should
should
should
should
should create
create
create
create
create
create
create
create
create and
and
and
and
and
and
and
and
and maintain
maintain
maintain
maintain
maintain
maintain
maintain
maintain
maintain either
either
either
either
either
either
either
either
either a
a
a
a
a
a
a
a
a Service
Service
Service
Service
Service
Service
Service
Service
Service Level
Level
Level
Level
Level
Level
Level
Level
Level
Agreement
Agreement
Agreement
Agreement
Agreement
Agreement
Agreement
Agreement
Agreement
or
or
or
or
or
or
or
or
or
a
a
a
a
a
a
a
a
a 
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum of
of
of
of
of
of
of
of
of
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding that
that
that
that
that
that
that
that
that formally
formally
formally
formally
formally
formally
formally
formally
formally defines
defines
defines
defines
defines
defines
defines
defines
defines
the
the
the
the
the
the
the
the
the
agreed
agreed
agreed
agreed
agreed
agreed
agreed
agreed
agreed level
level
level
level
level
level
level
level
level of
of
of
of
of
of
of
of
of
service
service
service
service
service
service
service
service
service
between
between
between
between
between
between
between
between
between
the
the
the
the
the
the
the
the
the 
two
two
two
two
two
two
two
two
two
departments.
departments.
departments.
departments.
departments.
departments.
departments.
departments.
departments. 
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response: 
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree with
with
with
with
with
with
with
with
with recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
-
-
-
-
-
-
-
-
-
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD provides
provides
provides
provides
provides
provides
provides
provides
provides lOS-related
lOS-related
lOS-related
lOS-related
lOS-related
lOS-related
lOS-related
lOS-related
lOS-related services
services
services
services
services
services
services
services
services for
for
for
for
for
for
for
for
for
the
the
the
the
the
the
the
the
the benefit
benefit
benefit
benefit
benefit
benefit
benefit
benefit
benefit 
of
of
of
of
of
of
of
of
of
the
the
the
the
the
the
the
the
the City
City
City
City
City
City
City
City
City
and
and
and
and
and
and
and
and
and
City
City
City
City
City
City
City
City
City customers.
customers.
customers.
customers.
customers.
customers.
customers.
customers.
customers.
With
With
With
With
With
With
With
With
With
regard
regard
regard
regard
regard
regard
regard
regard
regard to
to
to
to
to
to
to
to
to
DSD's
DSD's
DSD's
DSD's
DSD's
DSD's
DSD's
DSD's
DSD's
processing
processing
processing
processing
processing
processing
processing
processing
processing
permits
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
permits
permits
permits
permits
permits
permits
permits
permits
and
and
and
and
and
and
and
and
and
collection
collection
collection
collection
collection
collection
collection
collection
collection
of
of
of
of
of
of
of
of
of
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS related
related
related
related
related
related
related
related
related fees,
fees,
fees,
fees,
fees,
fees,
fees,
fees,
fees,
the
the
the
the
the
the
the
the
the
Public
Public
Public
Public
Public
Public
Public
Public
Public Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
and
and
and
and
and
and
and
and
and Development
Development
Development
Development
Development
Development
Development
Development
Development
Services
Services
Services
Services
Services
Services
Services
Services
Services
departments
departments
departments
departments
departments
departments
departments
departments
departments
(the
(the
(the
(the
(the
(the
(the
(the
(the Departments)
Departments)
Departments)
Departments)
Departments)
Departments)
Departments)
Departments)
Departments)
are
are
are
are
are
are
are
are
are
fully
fully
fully
fully
fully
fully
fully
fully
fully
committed
committed
committed
committed
committed
committed
committed
committed
committed
to
to
to
to
to
to
to
to
to
working
working
working
working
working
working
working
working
working
together
together
together
together
together
together
together
together
together to
to
to
to
to
to
to
to
to
of
lOS
improve
improve
improve
improve
improve
improve
improve
improve
improve the
the
the
the
the
the
the
the
the skill
skill
skill
skill
skill
skill
skill
skill
skill and
and
and
and
and
and
and
and
and knowledge
knowledge
knowledge
knowledge
knowledge
knowledge
knowledge
knowledge
knowledge
employees,
oftheir
oftheir
oftheir
oftheir
oftheir
oftheir
oftheir
oftheir
employees,
employees,
employees,
employees,
employees,
employees,
employees,
employees, the
the
the
the
the
the
the
the
the
level
level
level
level
level
level
level
level
level of
of
of
of
of
of
of
of
of
service
service
service
service
service
service
service
service
service
provided
provided
provided
provided
provided
provided
provided
provided
provided
of
their
to
to
to
to
to
to
to
to
to
City
City
City
City
City
City
City
City
City customers
customers
customers
customers
customers
customers
customers
customers
customers
and
and
and
and
and
and
and
and
and
the
the
the
the
the
the
the
the
the consistency
consistency
consistency
consistency
consistency
consistency
consistency
consistency
consistency
related
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS
ofIOS related
related
related
related
related
related
related
related processes.
processes.
processes.
processes.
processes.
processes.
processes.
processes.
processes.
of
lOS
The
The
The
The
The
The
The
The
The Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments
will
will
will
will
will
will
will
will
will begin
begin
begin
begin
begin
begin
begin
begin
begin developing
developing
developing
developing
developing
developing
developing
developing
developing a
a
a
a
a
a
a
a
a Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
Memorandum
of
of
of
of
of
of
of
of
of
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
Understanding
(MOU)
(MOU)
(MOU)
(MOU)
(MOU)
(MOU)
(MOU)
(MOU)
(MOU)
to
to
to
to
to
to
to
to
to
further
further
further
further
further
further
further
further
further
delineate
delineate
delineate
delineate
delineate
delineate
delineate
delineate
delineate expectations
expectations
expectations
expectations
expectations
expectations
expectations
expectations
expectations and
and
and
and
and
and
and
and
and responsibilities
responsibilities
responsibilities
responsibilities
responsibilities
responsibilities
responsibilities
responsibilities
responsibilities related
related
related
related
related
related
related
related
related to
to
to
to
to
to
to
to
to
the
the
the
the
the
the
the
the
the assessment,
assessment,
assessment,
assessment,
assessment,
assessment,
assessment,
assessment,
assessment,
collection
collection
collection
collection
collection
collection
collection
collection
collection and
and
and
and
and
and
and
and
and follow-up
follow-up
follow-up
follow-up
follow-up
follow-up
follow-up
follow-up
follow-up
of
of
of
of
of
of
of
of
of
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fees.
fees.
fees.
fees.
fees.
fees.
fees.
fees.
fees.
The
The
The
The
The
The
The
The
The MOU
MOU
MOU
MOU
MOU
MOU
MOU
MOU
MOU shall
shall
shall
shall
shall
shall
shall
shall
shall be
be
be
be
be
be
be
be
be
completed
completed
completed
completed
completed
completed
completed
completed
completed no
no
no
no
no
no
no
no
no
later
later
later
later
later
later
later
later
later than
than
than
than
than
than
than
than
than
December
December
December
December
December
December
December
December
December
and
31,2010
31,2010
31,2010
31,2010
31,2010
31,2010
31,2010
31,2010
and
and
and
and
and
and
and
and will
will
will
will
will
will
will
will
will include
include
include
include
include
include
include
include
include the
the
the
the
the
the
the
the
the following:
following:
following:
following:
following:
following:
following:
following:
following:
31, 2010
..
Responsibility
Responsibility
Responsibility
Responsibility
Responsibility
Responsibility
Responsibility
Responsibility
Responsibility matrix
matrix
matrix
matrix
matrix
matrix
matrix
matrix
matrix•
•
•
•
•
•
•
• 
..
Communication
Communication
Communication
Communication
Communication
Communication
Communication
Communication
Communication Plan
Plan
Plan
Plan
Plan
Plan
Plan
Plan
Plan
(contacts,
(contacts,
(contacts,
(contacts,
(contacts,
(contacts,
(contacts,
(contacts,
(contacts, monthly
monthly
monthly
monthly
monthly
monthly
monthly
monthly
monthly meetings)
meetings)
meetings)
meetings)
meetings)
meetings)
meetings)
meetings)
meetings)•
•
•
•
•
•
•
• 
..
Training
Training
Training
Training
Training
Training
Training
Training
Training
Plan
Plan
Plan
Plan
Plan
Plan
Plan
Plan
Plan (content,
(content,
(content,
(content,
(content,
(content,
(content,
(content,
(content,
schedule,
schedule,
schedule,
schedule,
schedule,
schedule,
schedule,
schedule,
schedule, who
who
who
who
who
who
who
who
who
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)
develops/coordinates/delivers)•
•
•
•
•
•
•
• 
..
..
..
..
..
..
..
..
..
Development/maintenance
Development/maintenance
Development/maintenance
Development/maintenance
Development/maintenance
Development/maintenance
Development/maintenance
Development/maintenance
Development/maintenance Plan
Plan
Plan
Plan
Plan
Plan
Plan
Plan
Plan for
for
for
for
for
for
for
for
for
shared
shared
shared
shared
shared
shared
shared
shared
shared
document
document
document
document
document
document
document
document
document
repository
repository
repository
repository
repository
repository
repository
repository
repository 
..
..
..
..
..
..
..
..
..
Exception
Exception
Exception
Exception
Exception
Exception
Exception
Exception
Exception (non-standard
(non-standard
(non-standard
(non-standard
(non-standard
(non-standard
(non-standard
(non-standard
(non-standard lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fee
fee
fee
fee
fee
fee
fee
fee
fee
assessment)
assessment)
assessment)
assessment)
assessment)
assessment)
assessment)
assessment)
assessment) 
..
..
..
..
..
..
..
..
..
Escalation
Escalation
Escalation
Escalation
Escalation
Escalation
Escalation
Escalation
Escalation process
process
process
process
process
process
process
process
process 
..
..
..
..
..
..
..
..
..
Fee
Fee
Fee
Fee
Fee
Fee
Fee
Fee
Fee Deferral/waiver
Deferral/waiver
Deferral/waiver
Deferral/waiver
Deferral/waiver
Deferral/waiver
Deferral/waiver
Deferral/waiver
Deferral/waiver
process
process
process
process
process
process
process
process
process 
Page
Page
Page
Page
Page
Page
Page
Page
Page 2
2
2
2
2
2
2
2
2
Attachment A
Department
Department
Department
Department
Department
Department
Department
Department
Department
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Responses
PennitWater
Water
Water
Water
Water
Water
Water
Water
Water
and
and
and
and
and
and
and
and
and
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Fees
Permit
Permit
Permit
Permit
Permit
Permit
Permit
Permit Fees
Fees
Fees
Fees
Fees
Fees
Fees
Fees (lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS) Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection Process
Process
Process
Process
Process
Process
Process
Process
Process Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
JuneJune
June
June
June
June
June
June
June 18,201018,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
•
•
•
•
•
•
•
•
•
Error
Error
Error
Error
Error
Error
Error
Error
Error correction/update
correction/update
correction/update
correction/update
correction/update
correction/update
correction/update
correction/update
correction/update process
process
process
process
process
process
process
process
process
•
•
•
•
•
•
•
•
•
Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit of
of
of
of
of
of
of
of
of
water
water
water
water
water
water
water
water
water and
andand
and
and
and
and
and
and sewer
sewer
sewer
sewer
sewer
sewer
sewer
sewer
sewer fee
fee
fee
fee
fee
fee
fee
fee
fee
collection
collection
collection
collection
collection
collection
collection
collection
collection process
process
process
process
process
process
process
process
process
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation #3:
#3:
#3:
#3:
#3:
#3:
#3:
#3:
#3:
fonnalDSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
management
management
management
management
management
management
management
management
management should
should
should
should
should
should
should
should
should develop
develop
develop
develop
develop
develop
develop
develop
develop
written
formal
formal
formal
formal
formal
formal
formal
formal written
written
written
written
written
written
written
written policies
policiespolicies
policies
policies
policies
policies
policies
policies and
and
and
and
and
and
and
and
and procedures
procedures
procedures
procedures
procedures
procedures
procedures
procedures
procedures regarding
regarding
regarding
regarding
regarding
regarding
regarding
regarding
regarding the
the
the
the
the
the
the
the
the
pennit infonnationcollection
collection
collection
collectioncollection
collection
collection
collection
collection of
of
of
of
of
of
of
of
of
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fees
permit
permit
permit
permit
permit
permit
permit
permit fees
fees
fees
fees
fees
fees
fees
fees
to
toto
to
to
to
to
to
to
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure appropriate
appropriate
appropriate
appropriate
appropriate
appropriate
appropriate
appropriate
appropriate payments
paymentspayments
payments
payments
payments
payments
payments
payments are
are
are
are
are
are
are
are
are made
mademade
made
made
made
made
made
made
and
and
and
and
and
and
and
and
and
payment
payment
payment
payment
payment
payment
payment
payment
payment information
information
information
information
information
information
information
information
is
is
is
is
is
is
is
is
is transferred
transferred
transferred
transferred
transferred
transferred
transferred
transferred
transferred into
intointo
into
into
into
into
into
into lOS.
lOS.
lOS.
lOS.
lOS.
lOS.
lOS.
lOS.
lOS.
These
These
These
These
These
These
These
These
These
policies
policies
policies
policies
policies
policies
policies
policies
policies
and
and
and
and
and
and
and
and
and
procedures
procedures
procedures
procedures
procedures
procedures
procedures
procedures
procedures should
should
should
should
should
should
should
should
should be
be
be
be
be
be
be
be
be
monitored
monitored
monitored
monitored
monitored
monitored
monitored
monitored
monitored by
by
by
by
by
by
by
by
by
management
management
management
management
management
management
management
management
management for
forfor
for
for
for
for
for
for
effectiveness.
effectiveness.effectiveness.
effectiveness.
effectiveness.
effectiveness.
effectiveness.
effectiveness.
effectiveness.
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response: 
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree with
with
with
with
with
with
with
with
with
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services
will
will
will
will
will
will
will
will
will document
document
document
document
document
document
document
document
document the
the
the
the
the
the
the
the
the lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fonnalcollection
collection
collection
collection
collection
collection
collection
collection
collection process
process
process
process
process
process
process
process
process changes
changes
changes
changes
changes
changes
changes
changes
changes
it
it
it
it
it
it
it
it
it
has
has
has
has
has
has
has
has
has implemented
implemented
implemented
implemented
implemented
implemented
implemented
implemented
implemented into
into
into
into
into
into
into
into
into a
a
a
a
a
a
a
a
a
written
formal
formal
formal
formal
formal
formal
formal
formal written
written
written
written
written
written
written
written
policy
policy
policy
policy
policy
policy
policy
policy
policy
by
by
by
by
by
by
by
by
by
December
December
December
December
December
December
December
December
December
2010.
2010.
2010.
2010.
2010.
2010.
2010.
2010.
2010.
Management
Management
Management
Management
Management
Management
Management
Management
Management is
is
is
is
is
is
is
is
is
already
already
already
already
already
already
already
already
already
monitoring
monitoring
monitoring
monitoring
monitoring
monitoring
monitoring
monitoring
monitoring
the
the
the
the
the
the
the
the
the revised
revised
revised
revised
revised
revised
revised
revised
revised process.
process.
process.
process.
process.
process.
process.
process.
process.
Recommendation
RecommendationRecommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
#4:
#4:
#4:
#4:
#4:
#4:
#4:
#4:
#4:
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
should
should
should
should
should
should
should
should
should continue
continue
continue
continue
continue
continue
continue
continue
continue implementation
implementationimplementation
implementation
implementation
implementation
implementation
implementation
implementation of
of
of
of
of
of
of
of
of
the
thethe
the
the
the
the
the
the newly
newly
newly
newly
newly
newly
newly
newly
newly
developed
developed
developed
developed
developed
developed
developed
developed
developed recovery
recovery
recovery
recovery
recovery
recovery
recovery
recovery
recovery
practices,
practices,
practices,
practices,
practices,
practices,
practices,
practices,
practices, including
including
including
including
including
including
including
including
including
how
how
how
how
how
how
how
how
how
unpaidunpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid feesfees
fees
fees
fees
fees
fees
fees
fees willwill
will
will
will
will
will
will
will bebe
be
be
be
be
be
be
be referredreferred
referred
referred
referred
referred
referred
referred
referred toto
to
to
to
to
to
to
to Collections,Collections,
Collections,
Collections,
Collections,
Collections,
Collections,
Collections,
Collections, inin
in
in
in
in
in
in
in orderorder
order
order
order
order
order
order
order toto
to
to
to
to
to
to
to recouprecoup
recoup
recoup
recoup
recoup
recoup
recoup
recoup unpaidunpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid
unpaid feesfees
fees
fees
fees
fees
fees
fees
fees whilewhile
while
while
while
while
while
while
while sharingsharing
sharing
sharing
sharing
sharing
sharing
sharing
sharing
infonnationmonitoringmonitoring
monitoring
monitoring
monitoring
monitoring
monitoring
monitoring
monitoring andand
and
and
and
and
and
and
and recoveryrecovery
recovery
recovery
recovery
recovery
recovery
recovery
recovery
of
information
information
information
information
information
information
information
information of
of
of
of
of
of
of
of
delinquent
delinquent
delinquent
delinquent
delinquent
delinquent
delinquent
delinquent
delinquent
accounts
accounts
accounts
accounts
accounts
accounts
accounts
accounts
accounts with
with
with
with
with
with
with
with
with Public
Public
Public
Public
Public
Public
Public
Public
Public Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
lOS
lOSlOS
lOS
lOS
lOS
lOS
lOS
lOS
Section.
Section.
Section.
Section.
Section.
Section.
Section.
Section.
Section.
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response: 
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree with
with
with
with
with
with
with
with
with recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services will
willwill
will
will
will
will
will
will continue
continue
continue
continue
continue
continue
continue
continue
continue
to
to
to
to
to
to
to
to
to
follow
follow
follow
follow
follow
follow
follow
follow
follow
its
its
its
its
its
its
its
its
its
revised
revised
revised
revised
revised
revised
revised
revised
revised collection
collection
collection
collection
collection
collection
collection
collection
collection process
process
process
process
process
process
process
process
process and
and
and
and
and
and
and
and
and make
make
make
make
make
make
make
make
make appropriate
appropriate
appropriate
appropriate
appropriate
appropriate
appropriate
appropriate
appropriate referrals
referrals
referrals
referrals
referrals
referrals
referrals
referrals
referrals to
to
to
to
to
to
to
to
to
collections.
collections.
collections.
collections.
collections.
collections.
collections.
collections.
collections.
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
#5:
#5:
#5:
#5:
#5:
#5:
#5:
#5:
#5: 
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
management,
management,
management,
management,
management,
management,
management,
management,
management,
in
in
in
in
in
in
in
in
in
conjunction
conjunctionconjunction
conjunction
conjunction
conjunction
conjunction
conjunction
conjunction
with
withwith
with
with
with
with
with
with the
the
the
the
the
the
the
the
the
Public
Public
Public
Public
Public
Public
Public
Public
Public
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
Utilities'
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
Section,
Section,
Section,
Section,
Section,
Section,
Section,
Section,
Section,
should
should
should
should
should
should
should
should
should create
create
create
create
create
create
create
create
create a
a
a
a
a
a
a
a
a 
pennitcommon
common
common
common
common
common
common
common
common repository
repository
repository
repository
repository
repository
repository
repository
repository that
that
that
that
that
that
that
that
that is
is
is
is
is
is
is
is
is updated
updated
updated
updated
updated
updated
updated
updated
updated as
as
as
as
as
as
as
as
as
rules
rules
rules
rules
rules
rules
rules
rules
rules or
or
or
or
or
or
or
or
or
procedures
procedures
procedures
procedures
procedures
procedures
procedures
procedures
procedures for
for
for
for
for
for
for
for
for the
the
the
the
the
the
the
the
the assessment
assessment
assessment
assessment
assessment
assessment
assessment
assessment
assessment of
of
of
of
of
of
of
of
of
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fees
permit
permit
permit
permit
permit
permit
permit
permit fees
fees
fees
fees
fees
fees
fees
fees
are
are
are
are
are
are
are
are
are
created
created
created
created
created
created
created
created
created or
or
or
or
or
or
or
or
or changed.
changed.
changed.
changed.
changed.
changed.
changed.
changed.
changed.
Response:
Response:Response:
Response:
Response:
Response:
Response:
Response:
Response: 
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree with
with
with
with
with
with
with
with
with recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
The
The
The
The
The
The
The
The
The
departments
departments
departments
departments
departments
departments
departments
departments
departments will
will
will
will
will
will
will
will
will include
include
include
include
include
include
include
include
include the
the
the
the
the
the
the
the
the process
process
process
process
process
process
process
process
process for
for
for
for
for
for
for
for
for
creation
creation
creation
creation
creation
creation
creation
creation
creation and
and
and
and
and
and
and
and
and maintenance
maintenance
maintenance
maintenance
maintenance
maintenance
maintenance
maintenance
maintenance of
of
of
of
of
of
of
of
of
the
the
the
the
the
the
the
the
the
shared
shared
shared
shared
shared
shared
shared
shared
shared repository
repository
repository
repository
repository
repository
repository
repository
repository in
in
in
in
in
in
in
in
in the
the
the
the
the
the
the
the
the MOU
MOU
MOU
MOU
MOU
MOU
MOU
MOU
MOU identified
identified
identified
identified
identified
identified
identified
identified
identified in
in
in
in
in
in
in
in
in
response
response
response
response
response
response
response
response
response to
to
to
to
to
to
to
to
to
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation
recommendation number
number
number
number
number
number
number
number
number
2.
2.2.
2.
2.
2.
2.
2.
2.
The
TheThe
The
The
The
The
The
The repository
repositoryrepository
repository
repository
repository
repository
repository
repository
will
willwill
will
will
will
will
will
will be
be
be
be
be
be
be
be
be formally
formallyformally
formally
formally
formally
formally
formally
formally adopted
adopted
adopted
adopted
adopted
adopted
adopted
adopted
adopted
and
and
and
and
and
and
and
and
and
approved
approvedapproved
approved
approved
approved
approved
approved
approved by
byby
by
by
by
by
by
by
the
thethe
the
the
the
the
the
the Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments by
by
by
by
by
by
by
by
by
May
MayMay
May
May
May
May
May
May 1,
1,
1,
1,
1,
1,
1,
1,
1,
2011.
2011.2011.
2011.
2011.
2011.
2011.
2011.
2011.
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
#6:
#6:
#6:
#6:
#6:
#6:
#6:
#6:
#6: 
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
DSD
should
should
should
should
should
should
should
should
should implement
implementimplement
implement
implement
implement
implement
implement
implement a
a
a
a
a
a
a
a
a periodic
periodic
periodic
periodic
periodic
periodic
periodic
periodic
periodic review
review
review
review
review
review
review
review
review of
of
of
of
of
of
of
of
of
plans
plans
plans
plans
plans
plans
plans
plans
plans in
in
in
in
in
in
in
in
in
Supervisory
SupervisorySupervisory
Supervisory
Supervisory
Supervisory
Supervisory
Supervisory
Supervisory Clusters
Clusters
Clusters
Clusters
Clusters
Clusters
Clusters
Clusters
Clusters that
that
that
that
that
that
that
that
that regularly
regularly
regularly
regularly
regularly
regularly
regularly
regularly
regularly assess
assess
assess
assess
assess
assess
assess
assess
assess 
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
fees
fees
fees
fees
fees
fees
fees
fees
fees
and
and
and
and
and
and
and
and
and yearly
yearlyyearly
yearly
yearly
yearly
yearly
yearly
yearly training
training
training
training
training
training
training
training
training
sessions
sessions
sessions
sessions
sessions
sessions
sessions
sessions
sessions
in
in
in
in
in
in
in
in
in conjunction
conjunction
conjunction
conjunction
conjunction
conjunction
conjunction
conjunction
conjunction with
with
with
with
with
with
with
with
with Public
Public
Public
Public
Public
Public
Public
Public
Public Utilities.
Utilities.
Utilities.
Utilities.
Utilities.
Utilities.
Utilities.
Utilities.
Utilities. 
Response:Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response: 
fonnalizeAgree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
Agree
with
with
with
with
with
with
with
with
with
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
The
The
The
The
The
The
The
The
The Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments
Departments will
will
will
will
will
will
will
will
will
through
formalize
formalize
formalize
formalize
formalize
formalize
formalize
formalize through
through
through
through
through
through
through
through
the
the
the
the
the
the
the
the
the MOU
MOU
MOU
MOU
MOU
MOU
MOU
MOU
MOU
an
an
an
an
an
an
an
an
an implementation
implementation
implementation
implementation
implementation
implementation
implementation
implementation
implementation
plan
plan
plan
plan
plan
plan
plan
plan
plan which
which
which
which
which
which
which
which
which
dedication
identifies the
identifies the
identifies the
identifies the
identifies the
identifies the
identifies the
identifies the dedication
dedication
dedication
dedication
dedication
dedication
dedication
dedication of
of
of
of
of
of
of
of
of
resources
resources
resources
resources
resources
resources
resources
resources
resources needed
needed
needed
needed
needed
needed
needed
needed
needed in
in
in
in
in
in
in
in
in
identifies the
Page
Page
Page
Page
Page
Page
Page
Page
Page 3
3
3
3
3
3
3
3
3
Attachment A
Department
Department
Department
Department
Department
Department
Department
Department
Department
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Responses
Water
Water
Water
Water
Water
Water
Water
Water
Water
and
andand
and
and
and
and
and
and
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Sewer
Pennit
Pennit
Pennit
Pennit
Pennit
Pennit
Pennit
Pennit
Pennit
Fees
FeesFees
Fees
Fees
Fees
Fees
Fees
Fees (lOS)
(lOS)(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS)
(lOS) Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection
Collection Process
Process
Process
Process
Process
Process
Process
Process
Process Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
Audit
June
June
June
June
June
June
June
June
June
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
18,2010
order
order
order
order
order
order
order
order
order to
to
to
to
to
to
to
to
to
implement
implement
implement
implement
implement
implement
implement
implement
implement
this
this
this
this
this
this
this
this
this recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
The
The
The
The
The
The
The
The
The
first
first
first
first
first
first
first
first
first
training
training
training
training
training
training
training
training
training
will
will
will
will
will
will
will
will
will be
be
be
be
be
be
be
be
be
provided
provided
provided
provided
provided
provided
provided
provided
provided by
by
by
by
by
by
by
by
by
December
December
December
December
December
December
December
December
December 31,2010.
31,2010.
31,2010.
31,2010.
31,2010.
31,2010.
31,2010.
31,2010.
31,2010.
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation
Recommendation #7:
#7:
#7:
#7:
#7:
#7:
#7:
#7:
#7:
Public
PublicPublic
Public
Public
Public
Public
Public
Public Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
should
should
should
should
should
should
should
should
should work
work
work
work
work
work
work
work
work
with
with
with
with
with
with
with
with
with implementation
implementation
implementation
implementation
implementation
implementation
implementation
implementation
implementation consultants
consultants
consultants
consultants
consultants
consultants
consultants
consultants
consultants as
as
as
as
as
as
as
as
as
planned
planned
planned
planned
planned
planned
planned
planned
planned to
to
to
to
to
to
to
to
to
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure maximum
maximum
maximum
maximum
maximum
maximum
maximum
maximum
maximum
efficiencies
efficiencies
efficiencies
efficiencies
efficiencies
efficiencies
efficiencies
efficiencies
efficiencies are
are
are
are
are
are
are
are
are
gained
gained
gained
gained
gained
gained
gained
gained
gained through
through
through
through
through
through
through
through
through interfacing
interfacing
interfacing
interfacing
interfacing
interfacing
interfacing
interfacing
interfacing with
with
with
with
with
with
with
with
with
all
all
all
all
all
all
all
all
all process
process
process
process
process
process
process
process
process related
related
related
related
related
related
related
related
related applications,
applications,
applications,
applications,
applications,
applications,
applications,
applications,
applications, including
including
including
including
including
including
including
including
including
Development
DevelopmentDevelopment
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services Department's
Department's
Department's
Department's
Department's
Department's
Department's
Department's
Department's
(DSD)
(DSD)
(DSD)
(DSD)
(DSD)
(DSD)
(DSD)
(DSD)
(DSD) Project
ProjectProject
Project
Project
Project
Project
Project
Project
Tracking
TrackingTracking
Tracking
Tracking
Tracking
Tracking
Tracking
Tracking System.
System.
System.
System.
System.
System.
System.
System.
System.
DSD
DSDDSD
DSD
DSD
DSD
DSD
DSD
DSD
should
shouldshould
should
should
should
should
should
should be
be
be
be
be
be
be
be
be
included
included
included
included
included
included
included
included
included
on
on
on
on
on
on
on
on
on the
the
the
the
the
the
the
the
the relative
relative
relative
relative
relative
relative
relative
relative
relative interfaces
interfacesinterfaces
interfaces
interfaces
interfaces
interfaces
interfaces
interfaces
and
and
and
and
and
and
and
and
and facilitate
facilitate
facilitate
facilitate
facilitate
facilitate
facilitate
facilitate
facilitate
automated
automatedautomated
automated
automated
automated
automated
automated
automated data
datadata
data
data
data
data
data
data
interfacing
interfacinginterfacing
interfacing
interfacing
interfacing
interfacing
interfacing
interfacing as
as
as
as
as
as
as
as
as
recommended
recommended
recommended
recommended
recommended
recommended
recommended
recommended
recommended and
and
and
and
and
and
and
and
and required
required
required
required
required
required
required
required
required
by
by
by
by
by
by
by
by
by
the
the
the
the
the
the
the
the
the
implementing
implementing
implementing
implementing
implementing
implementing
implementing
implementing
implementing consultant.
consultant.
consultant.
consultant.
consultant.
consultant.
consultant.
consultant.
consultant.
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response:
Response: 
Agree
AgreeAgree
Agree
Agree
Agree
Agree
Agree
Agree with
with
with
with
with
with
with
with
with
recommendation.
recommendation.recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
recommendation.
The
The
The
The
The
The
The
The
The
Public
PublicPublic
Public
Public
Public
Public
Public
Public
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Utilities
Customer
Customer
Customer
Customer
Customer
Customer
Customer
Customer
Customer
Care
Care
Care
Care
Care
Care
Care
Care
Care
Solutions
Solutions
Solutions
Solutions
Solutions
Solutions
Solutions
Solutions
Solutions
Utility
Utility
Utility
Utility
Utility
Utility
Utility
Utility
Utility
Billing
Billing
Billing
Billing
Billing
Billing
Billing
Billing
Billing (CCS)
(CCS)
(CCS)
(CCS)
(CCS)
(CCS)
(CCS)
(CCS)
(CCS)
project,
project,
project,
project,
project,
project,
project,
project,
project, fonnerly
fonnerly
fonnerly
fonnerly
fonnerly
fonnerly
fonnerly
fonnerly
fonnerly referred
referred
referred
referred
referred
referred
referred
referred
referred to
to
to
to
to
to
to
to
to
as
as
as
as
as
as
as
as
as
CIS/lOS
CIS/lOS
CIS/lOS
CIS/lOS
CIS/lOS
CIS/lOS
CIS/lOS
CIS/lOS
CIS/lOS Replacement
Replacement
Replacement
Replacement
Replacement
Replacement
Replacement
Replacement
Replacement
project,
project,
project,
project,
project,
project,
project,
project,
project, includes
includes
includes
includes
includes
includes
includes
includes
includes the
the
the
the
the
the
the
the
the
replacement
replacement
replacement
replacement
replacement
replacement
replacement
replacement
replacement of
of
of
of
of
of
of
of
of
the
thethe
the
the
the
the
the
the lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS
lOS system
system
system
system
system
system
system
system
system and
and
and
and
and
and
and
and
and
functionally.
functionally.
functionally.
functionally.
functionally.
functionally.
functionally.
functionally.
functionally.
A
A
A
A
A
A
A
A
A key
key
key
key
key
key
key
key
key
of
thisobjectiveobjective
objective
objective
objective
objective
objective
objective
objective project
ofthis
ofthis
ofthis
ofthis
ofthis
ofthis
ofthis
ofthis
project
project
project
project
project
project
project
project includesincludes
includes
includes
includes
includes
includes
includes
includes focusingfocusing
focusing
focusing
focusing
focusing
focusing
focusing
focusing onon
on
on
on
on
on
on
on efficiencyefficiency
efficiency
efficiency
efficiency
efficiency
efficiency
efficiency
efficiency through
through
through
through
through
through
through
through
through maximizingmaximizing
maximizing
maximizing
maximizing
maximizing
maximizing
maximizing
maximizing
opportunities
opportunities
opportunities
opportunities
opportunities
opportunities
opportunities
opportunities
opportunities for
for
for
for
for
for
for
for
for
automation
automation
automation
automation
automation
automation
automation
automation
automation and
and
and
and
and
and
and
and
and effective
effective
effective
effective
effective
effective
effective
effective
effective integration.
integration.
integration.
integration.
integration.
integration.
integration.
integration.
integration.
Improving
Improving
Improving
Improving
Improving
Improving
Improving
Improving
Improving the
the
the
the
the
the
the
the
the level
level
level
level
level
level
level
level
level
and
and
and
and
and
and
and
and
and
accuracyaccuracy
accuracy
accuracy
accuracy
accuracy
accuracy
accuracy
accuracy
of
of
of
of
of
of
of
of
of
thethe
the
the
the
the
the
the
the
data
data
data
data
data
data
data
data
data interfacesinterfaces
interfaces
interfaces
interfaces
interfaces
interfaces
interfaces
interfaces withwith
with
with
with
with
with
with
with PTSPTS
PTS
PTS
PTS
PTS
PTS
PTS
PTS isis
is
is
is
is
is
is
is consistentconsistent
consistent
consistent
consistent
consistent
consistent
consistent
consistent withwith
with
with
with
with
with
with
with thatthat
that
that
that
that
that
that
that objective.objective.
objective.
objective.
objective.
objective.
objective.
objective.
objective.
Relevant
Relevant
Relevant
Relevant
Relevant
Relevant
Relevant
Relevant
Relevant Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services staff
staff
staff
staff
staff
staff
staff
staff
staff
members
members
members
members
members
members
members
members
members
are
are
are
are
are
are
are
are
are being
being
being
being
being
being
being
being
being included
included
included
included
included
included
included
included
included
in
in
in
in
in
in
in
in
in the
the
the
the
the
the
the
the
the
current
current
current
current
current
current
current
current
current
blueprinting
blueprinting
blueprinting
blueprinting
blueprinting
blueprinting
blueprinting
blueprinting
blueprinting phase
phase
phase
phase
phase
phase
phase
phase
phase
of
of
of
of
of
of
of
of
of
this
this
this
this
this
this
this
this
this project
project
project
project
project
project
project
project
project to
to
to
to
to
to
to
to
to
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure
ensure
Project
Project
Project
Project
Project
Project
Project
Project
Project
Tracking
TrackingTracking
Tracking
Tracking
Tracking
Tracking
Tracking
Tracking
System
System
System
System
System
System
System
System
System
interface/requirements
interface/requirements
interface/requirements
interface/requirements
interface/requirements
interface/requirements
interface/requirements
interface/requirements
interface/requirements are
are
are
are
are
are
are
are
are
adequately
adequately
adequately
adequately
adequately
adequately
adequately
adequately
adequately
captured
capturedcaptured
captured
captured
captured
captured
captured
captured and
and
and
and
and
and
and
and
and included
includedincluded
included
included
included
included
included
included in
inin
in
in
in
in
in
in the
the
the
the
the
the
the
the
the to-be
to-be
to-be
to-be
to-be
to-be
to-be
to-be
to-be
processes/solutions
processes/solutions
processes/solutions
processes/solutions
processes/solutions
processes/solutions
processes/solutions
processes/solutions
processes/solutions associated
associated
associated
associated
associated
associated
associated
associated
associated with
with
with
with
with
with
with
with
with the
the
the
the
the
the
the
the
the project
project
project
project
project
project
project
project
project
implementation,
implementation,
implementation,
implementation,
implementation,
implementation,
implementation,
implementation,
implementation, which
which
which
which
which
which
which
which
which is
is
is
is
is
is
is
is
is
schedule
schedule
schedule
schedule
schedule
schedule
schedule
schedule
schedule
for
for
for
for
for
for
for
for
for
completion
completion
completion
completion
completion
completion
completion
completion
completion September
September
September
September
September
September
September
September
September
2011.
2011.
2011.
2011.
2011.
2011.
2011.
2011.
2011.
Respectfully
Respectfully
Respectfully
Respectfully
Respectfully
Respectfully
Respectfully
Respectfully
Respectfully Submitted:
Submitted:
Submitted:
Submitted:
Submitted:
Submitted:
Submitted:
Submitted:
Submitted:
roughton,
Kel
Kel
Kel
Kel
Kel
Kel
Kel
Kel roughton,
roughton,
roughton,
roughton,
roughton,
roughton,
roughton,
roughton,
Director
Director
Director
Director
Director
Director
Director
Director
Director
Development
Development
Development
Development
Development
Development
Development
Development
Development Services
Services
Services
Services
Services
Services
Services
Services
Services
Department
Department
Department
Department
Department
Department
Department
Department
Department
cc:
cc:
cc:
cc:
cc:
cc:
cc:
cc:
cc: 
Jay
Jay
Jay
Jay
Jay
Jay
Jay
Jay
Jay Goldstone,
Goldstone,
Goldstone,
Goldstone,
Goldstone,
Goldstone,
Goldstone,
Goldstone,
Goldstone, Chief
Chief
Chief
Chief
Chief
Chief
Chief
Chief
Chief
Operating
Operating
Operating
Operating
Operating
Operating
Operating
Operating
Operating Officer
Officer
Officer
Officer
Officer
Officer
Officer
Officer
Officer
Wall
Wall
Wall
Wall
Wall
Wall
Wall
Wall
Wally
y
y
y
y
y
y
y
y Hill,
Hill,
Hill,
Hill,
Hill,
Hill,
Hill,
Hill,
Hill,
Assistant
Assistant
Assistant
Assistant
Assistant
Assistant
Assistant
Assistant
Assistant Chief
Chief
Chief
Chief
Chief
Chief
Chief
Chief
Chief
Operating
Operating
Operating
Operating
Operating
Operating
Operating
Operating
Operating Officer
Officer
Officer
Officer
Officer
Officer
Officer
Officer
Officer
Page
Page
Page
Page
Page
Page
Page
Page
Page 4
4
4
4
4
4
4
4
4